Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6TB65

Protein Details
Accession A0A2J6TB65    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
2-24ASTQNTRGTRRKKTLIKKAHELGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, mito_nucl 11.333, nucl 9.5, cyto_mito 9.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MASTQNTRGTRRKKTLIKKAHELGKFFGFEVALVIRKQGKITTYQSIDHESWWPTKAEMVGEFAYPIPEKLLPRDLEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.85
4 0.83
5 0.82
6 0.8
7 0.78
8 0.72
9 0.63
10 0.56
11 0.49
12 0.42
13 0.33
14 0.27
15 0.18
16 0.15
17 0.13
18 0.11
19 0.09
20 0.08
21 0.09
22 0.1
23 0.1
24 0.11
25 0.11
26 0.11
27 0.14
28 0.18
29 0.22
30 0.23
31 0.24
32 0.25
33 0.28
34 0.28
35 0.24
36 0.23
37 0.2
38 0.2
39 0.19
40 0.18
41 0.14
42 0.15
43 0.15
44 0.14
45 0.13
46 0.16
47 0.15
48 0.15
49 0.15
50 0.14
51 0.15
52 0.13
53 0.13
54 0.11
55 0.14
56 0.16
57 0.2
58 0.27