Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6ST52

Protein Details
Accession A0A2J6ST52    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
43-66LQPGYSRHQDRRRREGPREWQHKFBasic
NLS Segment(s)
Subcellular Location(s) mito 15, extr 4, cyto_nucl 4, nucl 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024079  MetalloPept_cat_dom_sf  
Gene Ontology GO:0008237  F:metallopeptidase activity  
Amino Acid Sequences MPRSRPELPAISSVPGSSRRLKRLIKKWLGVLLPLYYSLSPVLQPGYSRHQDRRRREGPREWQHKFATDMTWLQNTGQFFLHELMHTRIANGADEPHITDEYVAPIPEGEKPGTNDIKAYGPRLVHNLAKRSLNQGGGATRASTNADSYAILANAICLDTNPPSGWWDTTGYFPGVPGKQNPSTAQDDFDDNNFPVSLYVDFDNSTDPSSSDATNVLAANLEAFGNGPPDPDDEVPTATTTAAPPPAKTTAPPSPAADTCGDSYKFVLDHFDVYGKNFDPTKFGTDGSGLKKQIQGCGALTGWSFKTLTSETYQWHASGNLPIGTKACVGRAVVSAGGASADGCHGAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.3
4 0.33
5 0.39
6 0.43
7 0.52
8 0.6
9 0.67
10 0.72
11 0.79
12 0.79
13 0.76
14 0.74
15 0.72
16 0.65
17 0.56
18 0.48
19 0.39
20 0.3
21 0.26
22 0.22
23 0.15
24 0.15
25 0.13
26 0.12
27 0.1
28 0.11
29 0.12
30 0.11
31 0.13
32 0.16
33 0.24
34 0.3
35 0.35
36 0.44
37 0.52
38 0.61
39 0.69
40 0.75
41 0.76
42 0.78
43 0.81
44 0.82
45 0.84
46 0.85
47 0.86
48 0.79
49 0.77
50 0.71
51 0.65
52 0.58
53 0.49
54 0.41
55 0.34
56 0.33
57 0.29
58 0.28
59 0.25
60 0.22
61 0.23
62 0.21
63 0.19
64 0.17
65 0.14
66 0.13
67 0.14
68 0.15
69 0.13
70 0.15
71 0.16
72 0.2
73 0.19
74 0.18
75 0.19
76 0.19
77 0.19
78 0.16
79 0.15
80 0.12
81 0.12
82 0.13
83 0.12
84 0.12
85 0.11
86 0.11
87 0.1
88 0.11
89 0.12
90 0.11
91 0.09
92 0.09
93 0.1
94 0.11
95 0.13
96 0.11
97 0.12
98 0.14
99 0.21
100 0.23
101 0.22
102 0.2
103 0.2
104 0.24
105 0.23
106 0.23
107 0.19
108 0.19
109 0.2
110 0.23
111 0.24
112 0.23
113 0.27
114 0.29
115 0.29
116 0.31
117 0.3
118 0.31
119 0.32
120 0.28
121 0.25
122 0.22
123 0.19
124 0.18
125 0.17
126 0.14
127 0.11
128 0.1
129 0.11
130 0.09
131 0.09
132 0.08
133 0.08
134 0.08
135 0.08
136 0.08
137 0.07
138 0.07
139 0.06
140 0.05
141 0.05
142 0.05
143 0.04
144 0.03
145 0.04
146 0.05
147 0.07
148 0.07
149 0.07
150 0.08
151 0.09
152 0.09
153 0.09
154 0.11
155 0.1
156 0.11
157 0.12
158 0.11
159 0.1
160 0.1
161 0.13
162 0.12
163 0.12
164 0.13
165 0.17
166 0.18
167 0.2
168 0.21
169 0.22
170 0.26
171 0.25
172 0.25
173 0.21
174 0.21
175 0.2
176 0.2
177 0.17
178 0.12
179 0.12
180 0.11
181 0.1
182 0.08
183 0.08
184 0.07
185 0.07
186 0.07
187 0.07
188 0.08
189 0.08
190 0.09
191 0.09
192 0.09
193 0.08
194 0.08
195 0.09
196 0.11
197 0.1
198 0.1
199 0.1
200 0.09
201 0.1
202 0.1
203 0.08
204 0.07
205 0.07
206 0.06
207 0.06
208 0.05
209 0.04
210 0.04
211 0.04
212 0.06
213 0.06
214 0.06
215 0.06
216 0.08
217 0.11
218 0.11
219 0.13
220 0.13
221 0.14
222 0.14
223 0.14
224 0.13
225 0.1
226 0.1
227 0.08
228 0.1
229 0.15
230 0.15
231 0.15
232 0.18
233 0.21
234 0.21
235 0.21
236 0.26
237 0.27
238 0.3
239 0.32
240 0.31
241 0.32
242 0.32
243 0.34
244 0.29
245 0.23
246 0.21
247 0.24
248 0.23
249 0.19
250 0.19
251 0.18
252 0.16
253 0.15
254 0.17
255 0.12
256 0.13
257 0.14
258 0.16
259 0.15
260 0.16
261 0.2
262 0.17
263 0.19
264 0.2
265 0.19
266 0.2
267 0.22
268 0.25
269 0.23
270 0.23
271 0.21
272 0.22
273 0.27
274 0.29
275 0.33
276 0.29
277 0.3
278 0.34
279 0.34
280 0.35
281 0.32
282 0.29
283 0.23
284 0.26
285 0.23
286 0.21
287 0.2
288 0.18
289 0.17
290 0.17
291 0.16
292 0.12
293 0.16
294 0.16
295 0.19
296 0.21
297 0.23
298 0.23
299 0.27
300 0.28
301 0.24
302 0.24
303 0.22
304 0.2
305 0.22
306 0.23
307 0.22
308 0.22
309 0.22
310 0.22
311 0.22
312 0.23
313 0.2
314 0.18
315 0.17
316 0.17
317 0.18
318 0.19
319 0.2
320 0.17
321 0.16
322 0.14
323 0.12
324 0.11
325 0.09
326 0.07
327 0.05
328 0.05