Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6SRS0

Protein Details
Accession A0A2J6SRS0    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MPYKKASHRKVRTGCIQCKRRRVKVRVSRDVIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, mito_nucl 12, nucl 3.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MPYKKASHRKVRTGCIQCKRRRVKVRVSRDVIPLLLHFSATAEANCFTCPVWPPRVFFLGLQAPTSLDHVNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.82
4 0.79
5 0.81
6 0.83
7 0.83
8 0.83
9 0.8
10 0.81
11 0.81
12 0.85
13 0.84
14 0.8
15 0.73
16 0.65
17 0.59
18 0.48
19 0.38
20 0.27
21 0.2
22 0.15
23 0.11
24 0.08
25 0.07
26 0.07
27 0.07
28 0.07
29 0.06
30 0.07
31 0.07
32 0.08
33 0.08
34 0.07
35 0.09
36 0.12
37 0.15
38 0.23
39 0.25
40 0.27
41 0.3
42 0.33
43 0.32
44 0.29
45 0.31
46 0.3
47 0.29
48 0.27
49 0.24
50 0.22
51 0.22
52 0.25