Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6T7N0

Protein Details
Accession A0A2J6T7N0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
2-49VSAKRHVPIVKKRTKKFARHQSDTYKCLDASWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
12-16KKRTK
Subcellular Location(s) mito 17.5, mito_nucl 11.666, cyto_nucl 5.833, cyto 5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKRHVPIVKKRTKKFARHQSDTYKCLDASWRKPKGIDNRVRRRFKGQMVMPSIGFGSNKKTRHMMPSGHKAFLVNNTRDVDLLLMHNKTFAAEISHAVSSRKRIEIVARAKELGVKVTNPKARVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.84
4 0.84
5 0.85
6 0.85
7 0.83
8 0.84
9 0.84
10 0.82
11 0.74
12 0.67
13 0.58
14 0.48
15 0.41
16 0.42
17 0.39
18 0.41
19 0.49
20 0.5
21 0.49
22 0.5
23 0.57
24 0.59
25 0.62
26 0.61
27 0.62
28 0.68
29 0.77
30 0.82
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.56
37 0.54
38 0.53
39 0.52
40 0.44
41 0.38
42 0.32
43 0.24
44 0.19
45 0.12
46 0.13
47 0.18
48 0.19
49 0.21
50 0.23
51 0.24
52 0.29
53 0.32
54 0.32
55 0.33
56 0.42
57 0.43
58 0.41
59 0.4
60 0.35
61 0.31
62 0.33
63 0.34
64 0.24
65 0.25
66 0.26
67 0.26
68 0.26
69 0.25
70 0.18
71 0.11
72 0.13
73 0.12
74 0.11
75 0.11
76 0.11
77 0.11
78 0.11
79 0.1
80 0.09
81 0.09
82 0.09
83 0.11
84 0.13
85 0.14
86 0.14
87 0.15
88 0.17
89 0.19
90 0.22
91 0.23
92 0.21
93 0.22
94 0.28
95 0.36
96 0.43
97 0.45
98 0.43
99 0.42
100 0.41
101 0.43
102 0.38
103 0.33
104 0.27
105 0.23
106 0.27
107 0.36
108 0.41
109 0.39
110 0.41
111 0.4