Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6T015

Protein Details
Accession A0A2J6T015    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MVRILHRRHRPPHPNRLPQPSVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
Amino Acid Sequences MVRILHRRHRPPHPNRLPQPSVTVLFRLFLPSHGFDRLMKYQNLYMPRGRFETEGREWYEQYNAAINEGKPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.87
4 0.8
5 0.7
6 0.65
7 0.57
8 0.49
9 0.39
10 0.34
11 0.24
12 0.21
13 0.19
14 0.17
15 0.14
16 0.12
17 0.15
18 0.15
19 0.16
20 0.16
21 0.17
22 0.15
23 0.19
24 0.22
25 0.23
26 0.21
27 0.21
28 0.22
29 0.25
30 0.28
31 0.26
32 0.27
33 0.25
34 0.27
35 0.28
36 0.27
37 0.26
38 0.24
39 0.29
40 0.29
41 0.32
42 0.34
43 0.34
44 0.33
45 0.33
46 0.33
47 0.27
48 0.24
49 0.24
50 0.2
51 0.2
52 0.24