Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6TIU3

Protein Details
Accession A0A2J6TIU3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-32ILGNKRVERLRKRPKETSSKAKTHydrophilic
NLS Segment(s)
PositionSequence
15-30RVERLRKRPKETSSKA
Subcellular Location(s) mito 17, nucl 5, cyto 4
Family & Domain DBs
Amino Acid Sequences AFILIMFSFILGNKRVERLRKRPKETSSKAKTMQKPFSKEPVKVLSISVIADGYNYYIGAVNEFNYLTAQNAGLRYVERGGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.26
3 0.35
4 0.44
5 0.52
6 0.61
7 0.69
8 0.75
9 0.78
10 0.82
11 0.84
12 0.82
13 0.82
14 0.79
15 0.75
16 0.74
17 0.74
18 0.73
19 0.71
20 0.72
21 0.68
22 0.66
23 0.62
24 0.65
25 0.6
26 0.53
27 0.49
28 0.44
29 0.39
30 0.33
31 0.3
32 0.21
33 0.17
34 0.17
35 0.12
36 0.08
37 0.06
38 0.06
39 0.06
40 0.05
41 0.05
42 0.04
43 0.04
44 0.06
45 0.06
46 0.08
47 0.08
48 0.08
49 0.09
50 0.09
51 0.09
52 0.08
53 0.09
54 0.09
55 0.09
56 0.09
57 0.1
58 0.11
59 0.12
60 0.12
61 0.12
62 0.13