Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3P0G2

Protein Details
Accession J3P0G2    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MGSPRRDRLRCRIRRRSKRRGQELALGPBasic
NLS Segment(s)
PositionSequence
7-20DRLRCRIRRRSKRR
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 8.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MGSPRRDRLRCRIRRRSKRRGQELALGPNLEALCLGDVQQPQACNPTTPSHPACCRWPVSRGRCRFPEDIPDEVQRRSQTQVSQRVVDTQHSWPDRKTAIRARSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.94
3 0.94
4 0.94
5 0.94
6 0.93
7 0.91
8 0.84
9 0.82
10 0.79
11 0.74
12 0.66
13 0.55
14 0.44
15 0.38
16 0.33
17 0.23
18 0.16
19 0.09
20 0.07
21 0.07
22 0.08
23 0.08
24 0.09
25 0.1
26 0.12
27 0.12
28 0.12
29 0.15
30 0.15
31 0.12
32 0.15
33 0.16
34 0.16
35 0.21
36 0.23
37 0.24
38 0.26
39 0.28
40 0.28
41 0.29
42 0.3
43 0.27
44 0.32
45 0.36
46 0.43
47 0.5
48 0.53
49 0.55
50 0.56
51 0.6
52 0.56
53 0.49
54 0.49
55 0.44
56 0.42
57 0.39
58 0.4
59 0.37
60 0.35
61 0.37
62 0.29
63 0.27
64 0.27
65 0.27
66 0.28
67 0.35
68 0.44
69 0.44
70 0.45
71 0.43
72 0.44
73 0.43
74 0.4
75 0.35
76 0.3
77 0.35
78 0.36
79 0.38
80 0.35
81 0.39
82 0.4
83 0.41
84 0.45
85 0.46