Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6TIX9

Protein Details
Accession A0A2J6TIX9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
43-65ADDGTPIPRKRRRRPPMCPAPDEBasic
NLS Segment(s)
PositionSequence
51-56RKRRRR
Subcellular Location(s) mito 8, plas 6, E.R. 4, extr 3, golg 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MPPHMHPRSRLTSSLFATTLFASFFVVALPHVLPCPAPRVLYADDGTPIPRKRRRRPPMCPAPDEENESKEDGLGAGIEEGGVEDGDMEGKGEKRVVKRECPVPKPGGIVGEILGFKSSSGEKGSKPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.41
3 0.33
4 0.3
5 0.27
6 0.22
7 0.15
8 0.12
9 0.09
10 0.08
11 0.08
12 0.06
13 0.06
14 0.05
15 0.07
16 0.07
17 0.06
18 0.07
19 0.07
20 0.07
21 0.08
22 0.12
23 0.12
24 0.12
25 0.12
26 0.16
27 0.18
28 0.21
29 0.21
30 0.17
31 0.17
32 0.17
33 0.18
34 0.19
35 0.2
36 0.25
37 0.33
38 0.42
39 0.51
40 0.62
41 0.71
42 0.76
43 0.82
44 0.85
45 0.88
46 0.85
47 0.78
48 0.7
49 0.65
50 0.57
51 0.53
52 0.42
53 0.32
54 0.27
55 0.25
56 0.21
57 0.14
58 0.13
59 0.07
60 0.06
61 0.05
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.02
71 0.02
72 0.02
73 0.03
74 0.03
75 0.04
76 0.05
77 0.06
78 0.07
79 0.09
80 0.14
81 0.18
82 0.27
83 0.32
84 0.38
85 0.44
86 0.53
87 0.6
88 0.6
89 0.63
90 0.58
91 0.55
92 0.51
93 0.46
94 0.38
95 0.29
96 0.26
97 0.19
98 0.18
99 0.16
100 0.13
101 0.12
102 0.1
103 0.1
104 0.11
105 0.12
106 0.11
107 0.16
108 0.19