Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6T6S6

Protein Details
Accession A0A2J6T6S6    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-40SNLPLQRIPRHSRTRSKRQRRVTIRFIPRQWHydrophilic
NLS Segment(s)
PositionSequence
4-35RSLRRHSNLPLQRIPRHSRTRSKRQRRVTIRF
Subcellular Location(s) nucl 16.5, mito_nucl 11.5, mito 5.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MRKRSLRRHSNLPLQRIPRHSRTRSKRQRRVTIRFIPRQWHRRDPAMAHWDLFNKKIEPFKRRTLKRSIFVPIRSTPANLGKEAIPKMIPSFPPNEDDYTRKKQKLDDRTPFDAENFHDNSSDVVNALTTPRILRAPRLVVPLLLRGCPRLTTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.74
3 0.72
4 0.71
5 0.7
6 0.72
7 0.72
8 0.75
9 0.77
10 0.82
11 0.85
12 0.89
13 0.89
14 0.89
15 0.92
16 0.91
17 0.91
18 0.89
19 0.88
20 0.87
21 0.85
22 0.78
23 0.76
24 0.75
25 0.76
26 0.73
27 0.72
28 0.66
29 0.64
30 0.65
31 0.59
32 0.59
33 0.56
34 0.5
35 0.41
36 0.38
37 0.36
38 0.33
39 0.31
40 0.25
41 0.19
42 0.2
43 0.27
44 0.32
45 0.34
46 0.38
47 0.46
48 0.54
49 0.58
50 0.61
51 0.64
52 0.65
53 0.63
54 0.61
55 0.58
56 0.54
57 0.5
58 0.49
59 0.4
60 0.36
61 0.32
62 0.28
63 0.24
64 0.25
65 0.24
66 0.2
67 0.19
68 0.17
69 0.21
70 0.21
71 0.19
72 0.13
73 0.12
74 0.13
75 0.15
76 0.15
77 0.13
78 0.16
79 0.17
80 0.2
81 0.21
82 0.22
83 0.22
84 0.25
85 0.3
86 0.36
87 0.42
88 0.42
89 0.42
90 0.46
91 0.53
92 0.61
93 0.64
94 0.65
95 0.65
96 0.68
97 0.69
98 0.62
99 0.53
100 0.45
101 0.36
102 0.32
103 0.27
104 0.22
105 0.2
106 0.19
107 0.19
108 0.18
109 0.16
110 0.1
111 0.08
112 0.07
113 0.07
114 0.08
115 0.08
116 0.07
117 0.08
118 0.1
119 0.15
120 0.16
121 0.21
122 0.26
123 0.31
124 0.34
125 0.39
126 0.37
127 0.35
128 0.36
129 0.38
130 0.33
131 0.31
132 0.28
133 0.25
134 0.26