Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6T6H9

Protein Details
Accession A0A2J6T6H9    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-22YWGYSKTRYRQVKKTSFPDTKHydrophilic
57-81IKQAAWCVKKQKRHRTISKKVMDEWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, mito_nucl 13.5, nucl 11
Family & Domain DBs
Amino Acid Sequences MYWGYSKTRYRQVKKTSFPDTKAKVVEALEACSIETIRRFCNRTFRWMDAYRKGLSIKQAAWCVKKQKRHRTISKKVMDEWDNMQKEGKEGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.81
4 0.78
5 0.74
6 0.74
7 0.68
8 0.63
9 0.56
10 0.49
11 0.41
12 0.34
13 0.35
14 0.26
15 0.23
16 0.18
17 0.16
18 0.16
19 0.13
20 0.13
21 0.08
22 0.1
23 0.1
24 0.13
25 0.17
26 0.2
27 0.21
28 0.32
29 0.33
30 0.38
31 0.41
32 0.4
33 0.43
34 0.46
35 0.5
36 0.44
37 0.46
38 0.39
39 0.36
40 0.35
41 0.29
42 0.27
43 0.25
44 0.22
45 0.22
46 0.28
47 0.3
48 0.33
49 0.36
50 0.43
51 0.46
52 0.54
53 0.6
54 0.65
55 0.72
56 0.79
57 0.85
58 0.85
59 0.9
60 0.91
61 0.89
62 0.82
63 0.75
64 0.73
65 0.65
66 0.57
67 0.53
68 0.52
69 0.46
70 0.42
71 0.42
72 0.34