Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6TJM0

Protein Details
Accession A0A2J6TJM0    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
42-68VNMRHARLSKPWRNKYKKIMRRFEANYHydrophilic
NLS Segment(s)
PositionSequence
32-60KADNKNKARVVNMRHARLSKPWRNKYKKI
Subcellular Location(s) nucl 19.5, mito_nucl 12.666, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences AEKERLTRKEGASKIIQKYGKITIEQGRKDIKADNKNKARVVNMRHARLSKPWRNKYKKIMRRFEANYWDVIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.53
4 0.44
5 0.45
6 0.46
7 0.39
8 0.32
9 0.32
10 0.32
11 0.38
12 0.38
13 0.39
14 0.36
15 0.34
16 0.34
17 0.35
18 0.36
19 0.38
20 0.43
21 0.49
22 0.52
23 0.56
24 0.57
25 0.53
26 0.49
27 0.45
28 0.44
29 0.45
30 0.44
31 0.44
32 0.45
33 0.45
34 0.42
35 0.45
36 0.5
37 0.49
38 0.54
39 0.6
40 0.68
41 0.76
42 0.82
43 0.84
44 0.86
45 0.86
46 0.86
47 0.86
48 0.8
49 0.81
50 0.79
51 0.77
52 0.74
53 0.66