Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6T3M9

Protein Details
Accession A0A2J6T3M9    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-21PESQEEKKARREREKALRDIBasic
NLS Segment(s)
PositionSequence
11-12RR
Subcellular Location(s) cyto 13, cyto_nucl 12.5, nucl 10, mito 1, plas 1, pero 1, cysk 1
Family & Domain DBs
Amino Acid Sequences MPESQEEKKARREREKALRDIAKEVIKDYKDQYRVDHHVTTGADSGEGAFVSEMAPDVVKVVVDKGSERGYVEIAGGGLEAFFIRTSPEQSGFSVAELQNGQMCMINGRSTVVYIRPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.77
4 0.79
5 0.74
6 0.66
7 0.62
8 0.57
9 0.5
10 0.41
11 0.37
12 0.34
13 0.3
14 0.3
15 0.3
16 0.33
17 0.34
18 0.34
19 0.35
20 0.36
21 0.4
22 0.43
23 0.4
24 0.32
25 0.31
26 0.31
27 0.29
28 0.22
29 0.17
30 0.12
31 0.1
32 0.1
33 0.06
34 0.06
35 0.05
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.04
45 0.04
46 0.03
47 0.03
48 0.04
49 0.05
50 0.06
51 0.06
52 0.08
53 0.09
54 0.1
55 0.1
56 0.1
57 0.09
58 0.09
59 0.09
60 0.07
61 0.06
62 0.05
63 0.05
64 0.04
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.05
72 0.06
73 0.09
74 0.12
75 0.15
76 0.16
77 0.17
78 0.2
79 0.18
80 0.18
81 0.21
82 0.19
83 0.19
84 0.18
85 0.18
86 0.17
87 0.17
88 0.16
89 0.12
90 0.13
91 0.12
92 0.13
93 0.14
94 0.12
95 0.14
96 0.14
97 0.13
98 0.15