Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6TE20

Protein Details
Accession A0A2J6TE20    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-27GQFSARKSAGNQKKHRCRVCEKRFVRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGQFSARKSAGNQKKHRCRVCEKRFVRPSALQIHIYSHTSEKPFKCEVEDCGKYFSVVSNLRRHGRMHQSQGIRQLPRSRSARELKEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.82
3 0.86
4 0.82
5 0.83
6 0.84
7 0.85
8 0.84
9 0.77
10 0.78
11 0.79
12 0.75
13 0.7
14 0.62
15 0.57
16 0.54
17 0.53
18 0.44
19 0.36
20 0.35
21 0.3
22 0.28
23 0.23
24 0.17
25 0.17
26 0.17
27 0.23
28 0.2
29 0.24
30 0.24
31 0.23
32 0.25
33 0.23
34 0.25
35 0.28
36 0.3
37 0.26
38 0.27
39 0.27
40 0.25
41 0.23
42 0.2
43 0.18
44 0.2
45 0.24
46 0.28
47 0.34
48 0.37
49 0.39
50 0.4
51 0.41
52 0.46
53 0.49
54 0.5
55 0.53
56 0.55
57 0.56
58 0.64
59 0.63
60 0.55
61 0.53
62 0.54
63 0.49
64 0.53
65 0.54
66 0.49
67 0.51
68 0.58