Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6T4L5

Protein Details
Accession A0A2J6T4L5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-30FPRYAKLKTNQNPSPKQKQKHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, mito 4, E.R. 3, vacu 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQICRHPFPPFPRYAKLKTNQNPSPKQKQKQMSLCLLPCFALFLTYVCMYVCMYACVCVCECVCCLPFRRLCLISFFTPVPFVPFVLLSRALSHYRLFPNLFLPPAPHGWDSAAPSSKCRPLRRSVHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.67
3 0.67
4 0.7
5 0.69
6 0.73
7 0.72
8 0.75
9 0.78
10 0.77
11 0.81
12 0.8
13 0.79
14 0.78
15 0.8
16 0.8
17 0.79
18 0.77
19 0.73
20 0.69
21 0.64
22 0.57
23 0.48
24 0.39
25 0.3
26 0.24
27 0.17
28 0.11
29 0.08
30 0.07
31 0.09
32 0.09
33 0.1
34 0.08
35 0.09
36 0.08
37 0.09
38 0.08
39 0.06
40 0.06
41 0.07
42 0.08
43 0.08
44 0.08
45 0.09
46 0.08
47 0.09
48 0.09
49 0.1
50 0.1
51 0.11
52 0.13
53 0.17
54 0.19
55 0.2
56 0.25
57 0.24
58 0.24
59 0.27
60 0.28
61 0.23
62 0.24
63 0.22
64 0.18
65 0.18
66 0.17
67 0.16
68 0.12
69 0.11
70 0.09
71 0.1
72 0.1
73 0.12
74 0.13
75 0.1
76 0.12
77 0.15
78 0.16
79 0.16
80 0.17
81 0.19
82 0.21
83 0.24
84 0.24
85 0.22
86 0.24
87 0.24
88 0.24
89 0.2
90 0.19
91 0.18
92 0.2
93 0.23
94 0.2
95 0.19
96 0.2
97 0.22
98 0.24
99 0.27
100 0.32
101 0.29
102 0.33
103 0.37
104 0.43
105 0.48
106 0.53
107 0.52
108 0.55