Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6T8H7

Protein Details
Accession A0A2J6T8H7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
125-168AHRFLVEKRRLRRLRKQMEEMGRGKGEDRKRKREEDSPERKYKPBasic
NLS Segment(s)
PositionSequence
131-165EKRRLRRLRKQMEEMGRGKGEDRKRKREEDSPERK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MCYYIPILHLHCGCTTFELPVPNPCRDALKNSMPCLYIPEPVSRPTSLDSAPGLSYTPSTVSQRSDSSWQTRGSASSLIAPNYQHPIDAFKEDDVVKELTLCPFHEEDWLERDMQESGREKVGLAHRFLVEKRRLRRLRKQMEEMGRGKGEDRKRKREEDSPERKYKPHLWQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.19
4 0.2
5 0.23
6 0.23
7 0.31
8 0.35
9 0.32
10 0.33
11 0.31
12 0.35
13 0.32
14 0.37
15 0.35
16 0.41
17 0.44
18 0.45
19 0.47
20 0.42
21 0.4
22 0.4
23 0.35
24 0.29
25 0.25
26 0.28
27 0.27
28 0.29
29 0.32
30 0.25
31 0.25
32 0.23
33 0.24
34 0.19
35 0.19
36 0.17
37 0.16
38 0.15
39 0.14
40 0.12
41 0.1
42 0.1
43 0.08
44 0.09
45 0.1
46 0.12
47 0.13
48 0.15
49 0.17
50 0.18
51 0.19
52 0.22
53 0.23
54 0.25
55 0.28
56 0.26
57 0.26
58 0.25
59 0.24
60 0.21
61 0.19
62 0.15
63 0.15
64 0.15
65 0.15
66 0.15
67 0.14
68 0.14
69 0.16
70 0.16
71 0.11
72 0.1
73 0.12
74 0.13
75 0.14
76 0.13
77 0.1
78 0.12
79 0.12
80 0.13
81 0.12
82 0.11
83 0.09
84 0.1
85 0.1
86 0.09
87 0.1
88 0.1
89 0.1
90 0.11
91 0.11
92 0.13
93 0.14
94 0.14
95 0.16
96 0.17
97 0.14
98 0.14
99 0.14
100 0.13
101 0.12
102 0.16
103 0.15
104 0.16
105 0.17
106 0.18
107 0.17
108 0.21
109 0.28
110 0.27
111 0.26
112 0.27
113 0.27
114 0.29
115 0.3
116 0.34
117 0.34
118 0.39
119 0.43
120 0.51
121 0.59
122 0.65
123 0.75
124 0.77
125 0.8
126 0.81
127 0.83
128 0.81
129 0.82
130 0.81
131 0.73
132 0.67
133 0.57
134 0.48
135 0.43
136 0.41
137 0.42
138 0.45
139 0.52
140 0.57
141 0.63
142 0.7
143 0.75
144 0.76
145 0.77
146 0.77
147 0.79
148 0.78
149 0.81
150 0.77
151 0.73
152 0.72
153 0.7