Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6T0I8

Protein Details
Accession A0A2J6T0I8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
3-25LLCLWTRRRAGRRFRGELRPGKVHydrophilic
NLS Segment(s)
PositionSequence
11-16RAGRRF
Subcellular Location(s) mito 22, plas 3
Family & Domain DBs
Amino Acid Sequences MDLLCLWTRRRAGRRFRGELRPGKVSDERLLMVMAHDCKESYLVYVSVVSLFGAMGIPRQAAALSDSEGSPKRGWKCRPVSILEAFFNLTFYTLIRAAVDRPLSYLPCILH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.8
4 0.81
5 0.82
6 0.81
7 0.75
8 0.7
9 0.61
10 0.58
11 0.54
12 0.48
13 0.42
14 0.35
15 0.3
16 0.25
17 0.24
18 0.19
19 0.15
20 0.15
21 0.13
22 0.12
23 0.11
24 0.11
25 0.1
26 0.11
27 0.11
28 0.08
29 0.09
30 0.08
31 0.08
32 0.08
33 0.08
34 0.07
35 0.07
36 0.06
37 0.04
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.06
52 0.07
53 0.07
54 0.09
55 0.11
56 0.13
57 0.13
58 0.18
59 0.23
60 0.31
61 0.35
62 0.43
63 0.49
64 0.54
65 0.58
66 0.57
67 0.57
68 0.54
69 0.54
70 0.45
71 0.38
72 0.32
73 0.27
74 0.23
75 0.17
76 0.13
77 0.09
78 0.08
79 0.1
80 0.1
81 0.1
82 0.11
83 0.12
84 0.12
85 0.17
86 0.2
87 0.16
88 0.19
89 0.22
90 0.22
91 0.23