Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6TFF7

Protein Details
Accession A0A2J6TFF7    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20GAKAASKRARKDKDDKGVAKBasic
NLS Segment(s)
PositionSequence
10-10R
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039713  At2g23090-like  
IPR039438  At2g23090-like_Znf  
IPR026939  ZNF706/At2g23090_sf  
Pfam View protein in Pfam  
PF12907  zf-met2  
Amino Acid Sequences GAKAASKRARKDKDDKGVAKSQLKVNEQAKDIQCDICKSTFLKTTRAPALTEHATNKHSKTIEDCFPNFVVQPAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.77
3 0.73
4 0.72
5 0.7
6 0.65
7 0.58
8 0.53
9 0.5
10 0.48
11 0.49
12 0.45
13 0.43
14 0.39
15 0.42
16 0.39
17 0.35
18 0.33
19 0.28
20 0.25
21 0.23
22 0.23
23 0.17
24 0.17
25 0.14
26 0.15
27 0.2
28 0.21
29 0.24
30 0.25
31 0.29
32 0.33
33 0.33
34 0.32
35 0.26
36 0.3
37 0.28
38 0.28
39 0.26
40 0.24
41 0.26
42 0.28
43 0.28
44 0.29
45 0.27
46 0.26
47 0.28
48 0.31
49 0.36
50 0.4
51 0.4
52 0.38
53 0.38
54 0.38
55 0.33