Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6SJK1

Protein Details
Accession A0A2J6SJK1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MVSKRNRTRRLRGNPGLKDHFRBasic
NLS Segment(s)
Subcellular Location(s) mito 9, plas 7, extr 4, E.R. 3, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVSKRNRTRRLRGNPGLKDHFREDAARILVDQIAGTQLRLWVCLTFPLTSDALHPVPAFPFRKPPFHCRVLLFSFLAPTWQLISLVLFEYLPFRSKVFLFSLLAADLYGDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.83
4 0.75
5 0.69
6 0.61
7 0.54
8 0.46
9 0.41
10 0.33
11 0.31
12 0.29
13 0.24
14 0.21
15 0.19
16 0.17
17 0.15
18 0.13
19 0.07
20 0.07
21 0.07
22 0.07
23 0.07
24 0.09
25 0.09
26 0.1
27 0.1
28 0.08
29 0.08
30 0.1
31 0.12
32 0.1
33 0.1
34 0.12
35 0.12
36 0.12
37 0.12
38 0.13
39 0.12
40 0.12
41 0.11
42 0.09
43 0.09
44 0.14
45 0.15
46 0.13
47 0.22
48 0.24
49 0.32
50 0.36
51 0.43
52 0.45
53 0.48
54 0.51
55 0.43
56 0.47
57 0.42
58 0.4
59 0.33
60 0.26
61 0.23
62 0.2
63 0.18
64 0.12
65 0.1
66 0.08
67 0.08
68 0.08
69 0.07
70 0.08
71 0.08
72 0.08
73 0.08
74 0.07
75 0.06
76 0.08
77 0.09
78 0.11
79 0.11
80 0.11
81 0.13
82 0.14
83 0.17
84 0.18
85 0.21
86 0.2
87 0.21
88 0.22
89 0.2
90 0.19
91 0.16