Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6SIZ1

Protein Details
Accession A0A2J6SIZ1    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
59-90GRDRCPKCDVERRKRRLQSPHLHKNRNKPSAVBasic
NLS Segment(s)
PositionSequence
70-95RRKRRLQSPHLHKNRNKPSAVTRRKK
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MPSSCVVIKTPFKHDGCTAEPPHVEYTYHREGACVMHKKMLQRYACREEKGESPSSFGGRDRCPKCDVERRKRRLQSPHLHKNRNKPSAVTRRKKDSISCCTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.42
4 0.46
5 0.41
6 0.37
7 0.36
8 0.35
9 0.36
10 0.31
11 0.27
12 0.21
13 0.27
14 0.28
15 0.3
16 0.27
17 0.24
18 0.24
19 0.27
20 0.33
21 0.32
22 0.27
23 0.29
24 0.31
25 0.34
26 0.39
27 0.42
28 0.39
29 0.38
30 0.44
31 0.48
32 0.51
33 0.48
34 0.44
35 0.39
36 0.38
37 0.37
38 0.35
39 0.27
40 0.25
41 0.25
42 0.24
43 0.23
44 0.2
45 0.2
46 0.19
47 0.28
48 0.28
49 0.3
50 0.32
51 0.34
52 0.39
53 0.46
54 0.53
55 0.55
56 0.64
57 0.68
58 0.76
59 0.81
60 0.82
61 0.82
62 0.81
63 0.81
64 0.81
65 0.85
66 0.84
67 0.87
68 0.84
69 0.85
70 0.85
71 0.82
72 0.73
73 0.67
74 0.67
75 0.69
76 0.75
77 0.74
78 0.71
79 0.73
80 0.76
81 0.77
82 0.75
83 0.74