Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6TIW6

Protein Details
Accession A0A2J6TIW6    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-32KEKANLARIRDNQRRSRARRKEYLQELEAHydrophilic
NLS Segment(s)
PositionSequence
19-22SRAR
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 7, cyto 3.5
Family & Domain DBs
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MSSKEKANLARIRDNQRRSRARRKEYLQELEARLRQCELQGIEASSEIQMAARRVADENKKLRGLLVQHGVGEDTIETYLQTSPTTDTMMGGQYGSSKKHLQPHTAPQRSSIYIPTTSTSNVNNCNYATDMITTMAGGDPSAVRQDLGCLPGMDCEVDNHLVFNVMDRYTGSVGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.73
3 0.78
4 0.82
5 0.81
6 0.85
7 0.85
8 0.85
9 0.86
10 0.84
11 0.84
12 0.83
13 0.82
14 0.74
15 0.7
16 0.65
17 0.61
18 0.58
19 0.49
20 0.4
21 0.33
22 0.3
23 0.23
24 0.25
25 0.19
26 0.18
27 0.19
28 0.18
29 0.18
30 0.17
31 0.17
32 0.12
33 0.1
34 0.07
35 0.07
36 0.08
37 0.08
38 0.09
39 0.09
40 0.1
41 0.11
42 0.18
43 0.23
44 0.29
45 0.33
46 0.36
47 0.37
48 0.36
49 0.35
50 0.32
51 0.29
52 0.26
53 0.25
54 0.22
55 0.21
56 0.21
57 0.2
58 0.16
59 0.14
60 0.08
61 0.05
62 0.04
63 0.04
64 0.04
65 0.04
66 0.05
67 0.05
68 0.06
69 0.06
70 0.07
71 0.07
72 0.08
73 0.07
74 0.07
75 0.07
76 0.08
77 0.07
78 0.06
79 0.05
80 0.07
81 0.09
82 0.09
83 0.12
84 0.14
85 0.17
86 0.25
87 0.28
88 0.31
89 0.35
90 0.45
91 0.53
92 0.56
93 0.53
94 0.49
95 0.49
96 0.45
97 0.41
98 0.34
99 0.26
100 0.21
101 0.22
102 0.2
103 0.17
104 0.17
105 0.17
106 0.17
107 0.17
108 0.22
109 0.22
110 0.23
111 0.22
112 0.22
113 0.22
114 0.2
115 0.17
116 0.12
117 0.12
118 0.11
119 0.11
120 0.09
121 0.08
122 0.07
123 0.07
124 0.06
125 0.05
126 0.05
127 0.06
128 0.08
129 0.08
130 0.07
131 0.07
132 0.11
133 0.12
134 0.14
135 0.15
136 0.13
137 0.13
138 0.15
139 0.16
140 0.13
141 0.11
142 0.11
143 0.13
144 0.15
145 0.15
146 0.14
147 0.13
148 0.15
149 0.14
150 0.16
151 0.16
152 0.13
153 0.14
154 0.14
155 0.18