Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6TII5

Protein Details
Accession A0A2J6TII5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
34-61FYITCTYFHRKRKVKKGRYPGGRKTFIFHydrophilic
NLS Segment(s)
PositionSequence
43-57RKRKVKKGRYPGGRK
Subcellular Location(s) mito 8, plas 8, E.R. 4, vacu 4, cyto_mito 4, mito_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000612  PMP3  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01679  Pmp3  
Amino Acid Sequences PPISVMLVAGPGMDCILNAIFFIAGVIPGHIHGFYITCTYFHRKRKVKKGRYPGGRKTFIFSEQVRNGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.06
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.03
11 0.03
12 0.03
13 0.04
14 0.03
15 0.04
16 0.05
17 0.04
18 0.04
19 0.04
20 0.04
21 0.05
22 0.07
23 0.06
24 0.07
25 0.09
26 0.16
27 0.23
28 0.31
29 0.41
30 0.48
31 0.58
32 0.69
33 0.78
34 0.82
35 0.85
36 0.88
37 0.88
38 0.9
39 0.9
40 0.9
41 0.88
42 0.84
43 0.75
44 0.69
45 0.62
46 0.54
47 0.51
48 0.43
49 0.43