Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6SUI9

Protein Details
Accession A0A2J6SUI9    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
252-286EESEAKKLRKVWPKKSAPRRSIDKKDRYSGQRRVAHydrophilic
NLS Segment(s)
PositionSequence
257-277KKLRKVWPKKSAPRRSIDKKD
Subcellular Location(s) cyto_nucl 12.5, cyto 12, nucl 9, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011333  SKP1/BTB/POZ_sf  
Amino Acid Sequences MATRGKYDLYVHGEPNHPHANRDLGGNFVLFYVGEDEDEASVHEKKLREHSQLFDNAFKLPRSELLPFLQHHLGERVSLSQYTGAIRLKHFHFRTKDMNTLIEWLYCSSLPMAMKFKDFCCLYYLASKFRMHKLLSELMDYIKTLHLDSGKVFEPTQISHIFKNRDAGGGQLWEYCAKQTIGCLAWGKERSSWVSEFKEVCRVNLDLGPALFQVLLASGKSIYKEQHGKACCARSSEAKTKKSMEGELSDVEESEAKKLRKVWPKKSAPRRSIDKKDRYSGQRRVANSVLEANEIARRLVEDGGIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.47
4 0.39
5 0.37
6 0.37
7 0.39
8 0.34
9 0.37
10 0.31
11 0.25
12 0.25
13 0.23
14 0.21
15 0.15
16 0.14
17 0.09
18 0.09
19 0.09
20 0.08
21 0.08
22 0.08
23 0.09
24 0.09
25 0.09
26 0.09
27 0.09
28 0.11
29 0.12
30 0.16
31 0.17
32 0.21
33 0.31
34 0.38
35 0.42
36 0.44
37 0.47
38 0.5
39 0.55
40 0.54
41 0.47
42 0.41
43 0.37
44 0.36
45 0.32
46 0.26
47 0.2
48 0.21
49 0.21
50 0.22
51 0.22
52 0.23
53 0.27
54 0.26
55 0.3
56 0.29
57 0.25
58 0.25
59 0.24
60 0.21
61 0.17
62 0.17
63 0.15
64 0.14
65 0.14
66 0.13
67 0.11
68 0.12
69 0.12
70 0.15
71 0.16
72 0.16
73 0.17
74 0.21
75 0.23
76 0.32
77 0.33
78 0.38
79 0.39
80 0.42
81 0.5
82 0.5
83 0.52
84 0.45
85 0.44
86 0.36
87 0.35
88 0.3
89 0.22
90 0.18
91 0.13
92 0.12
93 0.11
94 0.11
95 0.08
96 0.1
97 0.09
98 0.11
99 0.15
100 0.14
101 0.17
102 0.18
103 0.18
104 0.22
105 0.22
106 0.2
107 0.19
108 0.19
109 0.18
110 0.23
111 0.25
112 0.21
113 0.25
114 0.27
115 0.27
116 0.3
117 0.34
118 0.27
119 0.28
120 0.3
121 0.31
122 0.29
123 0.27
124 0.24
125 0.19
126 0.19
127 0.17
128 0.13
129 0.09
130 0.08
131 0.07
132 0.08
133 0.08
134 0.09
135 0.09
136 0.11
137 0.1
138 0.11
139 0.11
140 0.11
141 0.11
142 0.11
143 0.13
144 0.14
145 0.15
146 0.16
147 0.21
148 0.22
149 0.22
150 0.25
151 0.22
152 0.21
153 0.19
154 0.18
155 0.14
156 0.13
157 0.12
158 0.09
159 0.09
160 0.09
161 0.09
162 0.08
163 0.09
164 0.08
165 0.08
166 0.08
167 0.1
168 0.1
169 0.12
170 0.13
171 0.13
172 0.17
173 0.2
174 0.2
175 0.19
176 0.2
177 0.2
178 0.22
179 0.23
180 0.23
181 0.24
182 0.27
183 0.27
184 0.26
185 0.33
186 0.3
187 0.29
188 0.27
189 0.24
190 0.22
191 0.22
192 0.22
193 0.14
194 0.14
195 0.14
196 0.11
197 0.1
198 0.08
199 0.06
200 0.05
201 0.05
202 0.06
203 0.05
204 0.05
205 0.06
206 0.07
207 0.08
208 0.1
209 0.1
210 0.17
211 0.24
212 0.26
213 0.33
214 0.35
215 0.38
216 0.42
217 0.46
218 0.42
219 0.39
220 0.39
221 0.38
222 0.44
223 0.5
224 0.54
225 0.52
226 0.54
227 0.55
228 0.58
229 0.53
230 0.49
231 0.42
232 0.36
233 0.35
234 0.32
235 0.3
236 0.25
237 0.21
238 0.19
239 0.17
240 0.14
241 0.15
242 0.21
243 0.19
244 0.22
245 0.28
246 0.37
247 0.45
248 0.55
249 0.61
250 0.66
251 0.76
252 0.84
253 0.9
254 0.91
255 0.89
256 0.87
257 0.87
258 0.87
259 0.87
260 0.87
261 0.86
262 0.83
263 0.83
264 0.83
265 0.83
266 0.82
267 0.8
268 0.8
269 0.76
270 0.7
271 0.69
272 0.64
273 0.56
274 0.48
275 0.45
276 0.36
277 0.31
278 0.28
279 0.23
280 0.22
281 0.21
282 0.19
283 0.13
284 0.13
285 0.13
286 0.14