Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PJ87

Protein Details
Accession J3PJ87    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
66-87GSLRPGRRPMRRRDRNLARVVNHydrophilic
105-131LKENLRSRTCKNWRRQHNSPQRRAEYAHydrophilic
NLS Segment(s)
PositionSequence
69-78RPGRRPMRRR
Subcellular Location(s) nucl 13, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
Amino Acid Sequences MPSKFLHKGRSAAGIRHRRPLKGGCQRRVIAIRGDQDTALKKVEDEFYANAAGMTALASSPLPPAGSLRPGRRPMRRRDRNLARVVNAQVTVVLNILEKDKVPKLKENLRSRTCKNWRRQHNSPQRRAEYAKRYPEEPEEAEPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.55
3 0.61
4 0.62
5 0.54
6 0.57
7 0.57
8 0.58
9 0.58
10 0.66
11 0.62
12 0.67
13 0.66
14 0.66
15 0.64
16 0.55
17 0.49
18 0.45
19 0.42
20 0.36
21 0.36
22 0.3
23 0.29
24 0.29
25 0.25
26 0.21
27 0.16
28 0.14
29 0.16
30 0.18
31 0.16
32 0.15
33 0.15
34 0.15
35 0.15
36 0.15
37 0.12
38 0.1
39 0.08
40 0.06
41 0.05
42 0.03
43 0.03
44 0.03
45 0.03
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.06
52 0.07
53 0.13
54 0.16
55 0.2
56 0.26
57 0.33
58 0.39
59 0.47
60 0.53
61 0.58
62 0.66
63 0.72
64 0.73
65 0.77
66 0.81
67 0.8
68 0.81
69 0.74
70 0.65
71 0.59
72 0.53
73 0.44
74 0.34
75 0.25
76 0.17
77 0.14
78 0.12
79 0.08
80 0.07
81 0.05
82 0.06
83 0.07
84 0.07
85 0.07
86 0.1
87 0.15
88 0.2
89 0.23
90 0.29
91 0.35
92 0.44
93 0.54
94 0.6
95 0.66
96 0.68
97 0.72
98 0.7
99 0.74
100 0.76
101 0.75
102 0.76
103 0.76
104 0.79
105 0.81
106 0.86
107 0.86
108 0.87
109 0.89
110 0.89
111 0.89
112 0.82
113 0.8
114 0.76
115 0.75
116 0.73
117 0.72
118 0.72
119 0.65
120 0.62
121 0.59
122 0.59
123 0.56
124 0.5