Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3PBK6

Protein Details
Accession J3PBK6    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
129-148GSAPKRRAGRHTRTGRARAVBasic
NLS Segment(s)
PositionSequence
127-146RGGSAPKRRAGRHTRTGRAR
Subcellular Location(s) nucl 14, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR001754  OMPdeCOase_dom  
IPR011060  RibuloseP-bd_barrel  
Gene Ontology GO:0004590  F:orotidine-5'-phosphate decarboxylase activity  
GO:0006207  P:'de novo' pyrimidine nucleobase biosynthetic process  
Pfam View protein in Pfam  
PF00215  OMPdecase  
Amino Acid Sequences MNIDSQPRQTGGSSGLRRRSTSFKATDLSPRINLGPLITIFKPHVDVVRNLNKNTGRSLKALSEKHDFLIFQDGRPVDIGNNGLKTWRWSAYTARCAGLARRHPGSMFGSILAGRGGIDAPEATGGRGGSAPKRRAGRHTRTGRARAVPLLEVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.47
3 0.48
4 0.49
5 0.52
6 0.54
7 0.51
8 0.52
9 0.48
10 0.44
11 0.43
12 0.44
13 0.48
14 0.46
15 0.43
16 0.36
17 0.34
18 0.31
19 0.29
20 0.27
21 0.19
22 0.17
23 0.14
24 0.17
25 0.15
26 0.16
27 0.15
28 0.15
29 0.17
30 0.15
31 0.18
32 0.16
33 0.18
34 0.24
35 0.34
36 0.36
37 0.35
38 0.4
39 0.39
40 0.38
41 0.4
42 0.38
43 0.3
44 0.29
45 0.31
46 0.29
47 0.34
48 0.35
49 0.34
50 0.33
51 0.32
52 0.31
53 0.29
54 0.24
55 0.18
56 0.25
57 0.21
58 0.16
59 0.2
60 0.19
61 0.18
62 0.18
63 0.18
64 0.08
65 0.09
66 0.11
67 0.09
68 0.09
69 0.09
70 0.09
71 0.09
72 0.11
73 0.13
74 0.13
75 0.13
76 0.14
77 0.21
78 0.27
79 0.32
80 0.32
81 0.3
82 0.29
83 0.28
84 0.29
85 0.31
86 0.3
87 0.29
88 0.29
89 0.3
90 0.29
91 0.31
92 0.31
93 0.25
94 0.2
95 0.16
96 0.15
97 0.14
98 0.14
99 0.11
100 0.08
101 0.05
102 0.05
103 0.05
104 0.04
105 0.05
106 0.04
107 0.05
108 0.07
109 0.07
110 0.07
111 0.08
112 0.08
113 0.08
114 0.1
115 0.12
116 0.18
117 0.27
118 0.3
119 0.35
120 0.42
121 0.44
122 0.53
123 0.61
124 0.63
125 0.65
126 0.72
127 0.75
128 0.78
129 0.81
130 0.78
131 0.74
132 0.68
133 0.62
134 0.55