Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3PAC3

Protein Details
Accession J3PAC3    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
18-37YQYQPHQHHQHQYQHHQQQPHydrophilic
NLS Segment(s)
PositionSequence
325-331RGKRKRP
Subcellular Location(s) nucl 15, cyto 6, pero 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MPFYAPDPWFHIQQDQGYQYQPHQHHQHQYQHHQQQPQQRQQLDQQGQELQLQELQYHHHHRHQEPHQQPLQQQEQQQQLQQQEELLLLLFQESQQQLFQQQQQQGQQYDLRPQGPRARGARPPSGYVLDGQYPGLPGQPPYRPMYDLPRAGSRMAAQGMPVTRPGTLSPGQGPAAHAGLAGAPHQPVPGSQDLPALPGGYASQMLASQYMILPGQQQHQQQQQHHHHHHEQLPPPWHYPRSQPPTQQPAMPASPVPQQHPPMMGFPAPRPQQQPIAGPAGGMWGASDMVVGSYTLAPLPVGGGSGGGGVACAPAHAWAAAPQGRGKRKRPCPASAGAGAGDPRPVRKIRTSAASSSSATIAATSPDAPATMPATATATTTVAPAVGAEPSPTTIPAPAPAPALIAGQGDTGVTSPPLSEEEIRVLEALGPAVAATPPPQGPAAVPDDPAAADGQGDVPAAAAGEAAGEQEEAVVMPAAADEAAGEQEEEAVVAPAPAGNPRDLFGVDPVDCFAGFAPELNGELPEWLTEGWEPVNLDDLFSGPSLVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.37
3 0.36
4 0.36
5 0.36
6 0.36
7 0.41
8 0.4
9 0.42
10 0.47
11 0.52
12 0.58
13 0.65
14 0.71
15 0.71
16 0.77
17 0.79
18 0.8
19 0.8
20 0.77
21 0.75
22 0.76
23 0.77
24 0.78
25 0.75
26 0.68
27 0.66
28 0.66
29 0.71
30 0.66
31 0.58
32 0.52
33 0.47
34 0.45
35 0.44
36 0.37
37 0.27
38 0.24
39 0.21
40 0.18
41 0.15
42 0.18
43 0.22
44 0.29
45 0.33
46 0.37
47 0.45
48 0.48
49 0.58
50 0.63
51 0.67
52 0.64
53 0.69
54 0.68
55 0.64
56 0.62
57 0.61
58 0.61
59 0.55
60 0.55
61 0.52
62 0.55
63 0.53
64 0.54
65 0.5
66 0.45
67 0.42
68 0.38
69 0.31
70 0.24
71 0.21
72 0.18
73 0.13
74 0.09
75 0.06
76 0.06
77 0.06
78 0.05
79 0.1
80 0.11
81 0.12
82 0.12
83 0.13
84 0.15
85 0.2
86 0.25
87 0.27
88 0.32
89 0.36
90 0.41
91 0.46
92 0.44
93 0.43
94 0.42
95 0.37
96 0.39
97 0.38
98 0.37
99 0.33
100 0.37
101 0.43
102 0.42
103 0.47
104 0.44
105 0.46
106 0.49
107 0.53
108 0.57
109 0.51
110 0.5
111 0.46
112 0.44
113 0.38
114 0.33
115 0.29
116 0.23
117 0.21
118 0.18
119 0.15
120 0.14
121 0.13
122 0.13
123 0.11
124 0.11
125 0.16
126 0.19
127 0.22
128 0.24
129 0.26
130 0.27
131 0.28
132 0.34
133 0.37
134 0.37
135 0.37
136 0.38
137 0.37
138 0.35
139 0.34
140 0.27
141 0.23
142 0.21
143 0.18
144 0.13
145 0.15
146 0.16
147 0.15
148 0.16
149 0.13
150 0.12
151 0.13
152 0.13
153 0.15
154 0.15
155 0.17
156 0.17
157 0.19
158 0.19
159 0.19
160 0.19
161 0.16
162 0.15
163 0.13
164 0.11
165 0.08
166 0.07
167 0.07
168 0.07
169 0.06
170 0.06
171 0.06
172 0.06
173 0.06
174 0.06
175 0.1
176 0.13
177 0.13
178 0.13
179 0.16
180 0.16
181 0.17
182 0.17
183 0.13
184 0.1
185 0.09
186 0.09
187 0.06
188 0.06
189 0.05
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.05
196 0.05
197 0.06
198 0.05
199 0.05
200 0.07
201 0.08
202 0.11
203 0.15
204 0.17
205 0.21
206 0.28
207 0.34
208 0.36
209 0.45
210 0.52
211 0.57
212 0.59
213 0.61
214 0.58
215 0.59
216 0.61
217 0.57
218 0.53
219 0.49
220 0.51
221 0.47
222 0.46
223 0.43
224 0.39
225 0.34
226 0.35
227 0.39
228 0.41
229 0.43
230 0.45
231 0.49
232 0.55
233 0.55
234 0.5
235 0.42
236 0.38
237 0.34
238 0.29
239 0.22
240 0.16
241 0.19
242 0.19
243 0.2
244 0.2
245 0.21
246 0.22
247 0.23
248 0.22
249 0.19
250 0.19
251 0.18
252 0.15
253 0.14
254 0.21
255 0.21
256 0.23
257 0.24
258 0.24
259 0.27
260 0.28
261 0.29
262 0.24
263 0.26
264 0.23
265 0.2
266 0.18
267 0.14
268 0.12
269 0.09
270 0.06
271 0.03
272 0.03
273 0.03
274 0.03
275 0.02
276 0.03
277 0.03
278 0.03
279 0.03
280 0.03
281 0.03
282 0.04
283 0.04
284 0.03
285 0.03
286 0.04
287 0.03
288 0.03
289 0.03
290 0.03
291 0.03
292 0.03
293 0.03
294 0.03
295 0.02
296 0.02
297 0.03
298 0.02
299 0.02
300 0.02
301 0.03
302 0.03
303 0.04
304 0.04
305 0.05
306 0.09
307 0.11
308 0.12
309 0.15
310 0.21
311 0.29
312 0.36
313 0.42
314 0.49
315 0.56
316 0.65
317 0.69
318 0.67
319 0.64
320 0.62
321 0.58
322 0.5
323 0.42
324 0.32
325 0.27
326 0.22
327 0.17
328 0.15
329 0.11
330 0.1
331 0.13
332 0.14
333 0.17
334 0.21
335 0.26
336 0.26
337 0.34
338 0.37
339 0.35
340 0.38
341 0.37
342 0.33
343 0.3
344 0.27
345 0.19
346 0.15
347 0.13
348 0.09
349 0.07
350 0.07
351 0.07
352 0.06
353 0.06
354 0.07
355 0.06
356 0.07
357 0.08
358 0.07
359 0.07
360 0.07
361 0.08
362 0.08
363 0.09
364 0.08
365 0.08
366 0.08
367 0.08
368 0.07
369 0.06
370 0.05
371 0.05
372 0.05
373 0.05
374 0.05
375 0.05
376 0.06
377 0.07
378 0.07
379 0.08
380 0.08
381 0.08
382 0.09
383 0.1
384 0.11
385 0.11
386 0.12
387 0.11
388 0.12
389 0.11
390 0.11
391 0.1
392 0.09
393 0.08
394 0.07
395 0.07
396 0.06
397 0.05
398 0.05
399 0.05
400 0.05
401 0.05
402 0.05
403 0.06
404 0.07
405 0.09
406 0.1
407 0.11
408 0.14
409 0.15
410 0.15
411 0.15
412 0.13
413 0.12
414 0.11
415 0.1
416 0.07
417 0.06
418 0.05
419 0.06
420 0.05
421 0.05
422 0.06
423 0.08
424 0.09
425 0.1
426 0.11
427 0.11
428 0.11
429 0.15
430 0.2
431 0.18
432 0.18
433 0.17
434 0.18
435 0.17
436 0.18
437 0.14
438 0.08
439 0.07
440 0.06
441 0.06
442 0.06
443 0.06
444 0.05
445 0.05
446 0.05
447 0.05
448 0.05
449 0.04
450 0.03
451 0.03
452 0.03
453 0.03
454 0.04
455 0.04
456 0.03
457 0.04
458 0.04
459 0.04
460 0.04
461 0.04
462 0.04
463 0.04
464 0.04
465 0.04
466 0.04
467 0.04
468 0.03
469 0.04
470 0.05
471 0.05
472 0.05
473 0.05
474 0.05
475 0.05
476 0.05
477 0.05
478 0.05
479 0.05
480 0.05
481 0.05
482 0.05
483 0.06
484 0.1
485 0.12
486 0.13
487 0.14
488 0.15
489 0.17
490 0.17
491 0.18
492 0.17
493 0.2
494 0.19
495 0.19
496 0.19
497 0.18
498 0.17
499 0.16
500 0.13
501 0.11
502 0.1
503 0.11
504 0.11
505 0.11
506 0.12
507 0.12
508 0.13
509 0.1
510 0.11
511 0.1
512 0.09
513 0.09
514 0.08
515 0.1
516 0.09
517 0.11
518 0.11
519 0.13
520 0.13
521 0.13
522 0.19
523 0.18
524 0.18
525 0.16
526 0.16
527 0.15
528 0.15