Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6SS15

Protein Details
Accession A0A2J6SS15    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-37YISGNERVLRRRKRPKETSSKAKTVRHydrophilic
NLS Segment(s)
PositionSequence
21-32RRRKRPKETSSK
Subcellular Location(s) mito 14.5, nucl 11, cyto_mito 8.5
Family & Domain DBs
Amino Acid Sequences KNQAFVLIMSSYISGNERVLRRRKRPKETSSKAKTVRIPFGNQAIKTLSIPAIADRYNYYMGAVNEFDYLTAQNASLRHVERGGHQALEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.16
4 0.2
5 0.27
6 0.37
7 0.45
8 0.55
9 0.65
10 0.74
11 0.79
12 0.85
13 0.87
14 0.89
15 0.89
16 0.89
17 0.86
18 0.85
19 0.78
20 0.74
21 0.7
22 0.63
23 0.61
24 0.53
25 0.49
26 0.42
27 0.45
28 0.43
29 0.36
30 0.33
31 0.26
32 0.24
33 0.21
34 0.19
35 0.12
36 0.08
37 0.08
38 0.08
39 0.09
40 0.08
41 0.09
42 0.09
43 0.11
44 0.12
45 0.12
46 0.12
47 0.13
48 0.13
49 0.15
50 0.14
51 0.13
52 0.13
53 0.13
54 0.12
55 0.09
56 0.09
57 0.08
58 0.08
59 0.08
60 0.1
61 0.1
62 0.12
63 0.17
64 0.18
65 0.19
66 0.2
67 0.21
68 0.22
69 0.29
70 0.29