Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6TEY5

Protein Details
Accession A0A2J6TEY5    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
61-90AEERKRKEEEKKQKAKEEQERKKPQQAQGEBasic
NLS Segment(s)
PositionSequence
63-100ERKRKEEEKKQKAKEEQERKKPQQAQGERDRKEKNKKK
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MVTTHHCPGKSQGNCRGPAKTPRSKKTYCTQHQTYCPREGCDERRHLKTESCIKCDARQAAEERKRKEEEKKQKAKEEQERKKPQQAQGERDRKEKNKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.62
3 0.6
4 0.56
5 0.59
6 0.6
7 0.6
8 0.62
9 0.65
10 0.7
11 0.69
12 0.68
13 0.68
14 0.7
15 0.68
16 0.68
17 0.67
18 0.65
19 0.71
20 0.74
21 0.69
22 0.65
23 0.59
24 0.51
25 0.48
26 0.47
27 0.44
28 0.44
29 0.47
30 0.44
31 0.46
32 0.48
33 0.46
34 0.42
35 0.42
36 0.45
37 0.41
38 0.4
39 0.39
40 0.37
41 0.38
42 0.41
43 0.37
44 0.29
45 0.28
46 0.28
47 0.35
48 0.43
49 0.47
50 0.46
51 0.49
52 0.51
53 0.53
54 0.59
55 0.59
56 0.62
57 0.66
58 0.73
59 0.75
60 0.8
61 0.84
62 0.84
63 0.84
64 0.84
65 0.83
66 0.84
67 0.87
68 0.85
69 0.87
70 0.84
71 0.8
72 0.8
73 0.78
74 0.76
75 0.76
76 0.8
77 0.74
78 0.75
79 0.76
80 0.75