Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6T3P1

Protein Details
Accession A0A2J6T3P1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
525-544PDDMPPKKTWRNMPMRAVRAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR004841  AA-permease/SLC12A_dom  
IPR004762  Amino_acid_permease_fungi  
IPR004840  Amoino_acid_permease_CS  
Gene Ontology GO:0016020  C:membrane  
GO:0022857  F:transmembrane transporter activity  
GO:0006865  P:amino acid transport  
Pfam View protein in Pfam  
PF00324  AA_permease  
PROSITE View protein in PROSITE  
PS00218  AMINO_ACID_PERMEASE_1  
Amino Acid Sequences MSAESPHTEGEKDPKTYAVPETNGNDVEQGDHGIVVKANPLSRELKGRHMQMIAIGGAIGAGLFVGSGGALETGGPGSLVLGYIIIGSMLLCTVQALGELAVLFPVNGAFFTYIVRFVDPSLGFAVGWDYAIGWLTVLPFELTAAGITIRFWRDDINIGVWIAVFLFLLCVIQIFGVRGYGEVEFILSTIKIMGCAGFIILAIIIDCGGVGNQGYLGAKYWHNPGAFNNGFKGFCSVFVVAAFAFGGTELVGLAAAEAANPRKSLPQATKQVFWRISFFYILSLFLLGLIVPSDNPNLLNSSGANSKYSPFVIAIRLAGIKALPSIFNVIITISVISVANSCTFGSTRTMQALAERGMGPAFLAHVDKHGRPIWGVAIQLLFGLLAFIGEAKNATTVFNWLLSLSGLSYFFVWGCICLAHIRFRSAWKAQGHVKAELPYEAIFGVVGSWYGFLLNILCMIATFYTALYPVGGKPDPQAFFQSYLAGPIIVALFIGWKLYSRIWSWYVPAHEMDITSGRRSLELDPDDMPPKKTWRNMPMRAVRALF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.37
4 0.4
5 0.38
6 0.34
7 0.36
8 0.38
9 0.4
10 0.38
11 0.35
12 0.3
13 0.23
14 0.22
15 0.17
16 0.15
17 0.11
18 0.11
19 0.11
20 0.11
21 0.12
22 0.1
23 0.14
24 0.15
25 0.17
26 0.17
27 0.21
28 0.24
29 0.26
30 0.34
31 0.33
32 0.4
33 0.45
34 0.48
35 0.49
36 0.46
37 0.43
38 0.36
39 0.37
40 0.27
41 0.2
42 0.16
43 0.11
44 0.09
45 0.08
46 0.06
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.03
56 0.03
57 0.03
58 0.03
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.04
92 0.05
93 0.04
94 0.04
95 0.05
96 0.05
97 0.06
98 0.07
99 0.08
100 0.1
101 0.1
102 0.11
103 0.1
104 0.1
105 0.17
106 0.16
107 0.16
108 0.16
109 0.16
110 0.15
111 0.14
112 0.15
113 0.08
114 0.08
115 0.07
116 0.05
117 0.05
118 0.06
119 0.06
120 0.04
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.04
131 0.05
132 0.05
133 0.05
134 0.05
135 0.08
136 0.09
137 0.1
138 0.1
139 0.11
140 0.12
141 0.16
142 0.17
143 0.16
144 0.16
145 0.16
146 0.15
147 0.13
148 0.12
149 0.08
150 0.07
151 0.04
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.04
161 0.04
162 0.04
163 0.05
164 0.05
165 0.06
166 0.07
167 0.07
168 0.07
169 0.06
170 0.06
171 0.05
172 0.05
173 0.06
174 0.04
175 0.04
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.04
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.03
191 0.03
192 0.02
193 0.02
194 0.02
195 0.02
196 0.02
197 0.02
198 0.02
199 0.03
200 0.04
201 0.04
202 0.04
203 0.05
204 0.07
205 0.08
206 0.09
207 0.12
208 0.16
209 0.16
210 0.17
211 0.17
212 0.25
213 0.26
214 0.25
215 0.24
216 0.22
217 0.21
218 0.21
219 0.23
220 0.13
221 0.13
222 0.15
223 0.13
224 0.11
225 0.11
226 0.12
227 0.08
228 0.08
229 0.07
230 0.04
231 0.04
232 0.03
233 0.03
234 0.02
235 0.03
236 0.02
237 0.02
238 0.02
239 0.02
240 0.02
241 0.02
242 0.02
243 0.02
244 0.03
245 0.05
246 0.06
247 0.06
248 0.07
249 0.08
250 0.1
251 0.15
252 0.19
253 0.26
254 0.34
255 0.36
256 0.4
257 0.4
258 0.46
259 0.43
260 0.39
261 0.33
262 0.26
263 0.25
264 0.21
265 0.19
266 0.14
267 0.12
268 0.11
269 0.09
270 0.07
271 0.06
272 0.05
273 0.05
274 0.03
275 0.03
276 0.03
277 0.03
278 0.03
279 0.04
280 0.04
281 0.04
282 0.05
283 0.05
284 0.07
285 0.07
286 0.07
287 0.07
288 0.09
289 0.11
290 0.12
291 0.12
292 0.11
293 0.12
294 0.13
295 0.13
296 0.12
297 0.1
298 0.1
299 0.11
300 0.11
301 0.1
302 0.1
303 0.1
304 0.09
305 0.08
306 0.07
307 0.05
308 0.05
309 0.06
310 0.05
311 0.05
312 0.08
313 0.08
314 0.08
315 0.08
316 0.07
317 0.07
318 0.07
319 0.06
320 0.04
321 0.04
322 0.04
323 0.04
324 0.05
325 0.05
326 0.06
327 0.06
328 0.06
329 0.07
330 0.07
331 0.08
332 0.11
333 0.12
334 0.13
335 0.14
336 0.14
337 0.13
338 0.15
339 0.16
340 0.14
341 0.14
342 0.13
343 0.12
344 0.11
345 0.11
346 0.09
347 0.07
348 0.06
349 0.05
350 0.06
351 0.05
352 0.09
353 0.13
354 0.13
355 0.18
356 0.2
357 0.2
358 0.19
359 0.2
360 0.19
361 0.18
362 0.18
363 0.14
364 0.11
365 0.11
366 0.1
367 0.09
368 0.06
369 0.04
370 0.04
371 0.03
372 0.02
373 0.02
374 0.03
375 0.03
376 0.03
377 0.03
378 0.04
379 0.05
380 0.06
381 0.06
382 0.06
383 0.09
384 0.1
385 0.1
386 0.1
387 0.09
388 0.09
389 0.09
390 0.08
391 0.06
392 0.07
393 0.06
394 0.07
395 0.07
396 0.07
397 0.07
398 0.08
399 0.07
400 0.07
401 0.07
402 0.07
403 0.07
404 0.1
405 0.12
406 0.18
407 0.2
408 0.22
409 0.23
410 0.27
411 0.33
412 0.33
413 0.39
414 0.33
415 0.37
416 0.41
417 0.47
418 0.47
419 0.43
420 0.43
421 0.39
422 0.38
423 0.33
424 0.28
425 0.2
426 0.17
427 0.14
428 0.11
429 0.08
430 0.07
431 0.06
432 0.04
433 0.04
434 0.04
435 0.04
436 0.04
437 0.04
438 0.04
439 0.05
440 0.05
441 0.05
442 0.06
443 0.05
444 0.05
445 0.05
446 0.06
447 0.06
448 0.06
449 0.06
450 0.05
451 0.06
452 0.07
453 0.07
454 0.06
455 0.08
456 0.08
457 0.13
458 0.14
459 0.14
460 0.17
461 0.25
462 0.26
463 0.27
464 0.31
465 0.28
466 0.3
467 0.3
468 0.3
469 0.22
470 0.23
471 0.21
472 0.16
473 0.13
474 0.11
475 0.1
476 0.07
477 0.07
478 0.05
479 0.05
480 0.05
481 0.07
482 0.06
483 0.07
484 0.09
485 0.11
486 0.15
487 0.16
488 0.22
489 0.25
490 0.26
491 0.28
492 0.32
493 0.33
494 0.32
495 0.31
496 0.28
497 0.26
498 0.24
499 0.24
500 0.24
501 0.23
502 0.22
503 0.24
504 0.22
505 0.22
506 0.24
507 0.24
508 0.27
509 0.28
510 0.28
511 0.28
512 0.32
513 0.39
514 0.39
515 0.39
516 0.34
517 0.4
518 0.45
519 0.51
520 0.56
521 0.6
522 0.68
523 0.74
524 0.8
525 0.81
526 0.79