Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6SVD3

Protein Details
Accession A0A2J6SVD3    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
42-67VNMRHARLSKPWRNKYKKIMRRFEADHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
Amino Acid Sequences AEKECLARKEGAGKIIQKYGEITVEQGRKDIKADNEDEARVVNMRHARLSKPWRNKYKKIMRRFEADYWDVIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.36
4 0.29
5 0.27
6 0.25
7 0.21
8 0.17
9 0.16
10 0.19
11 0.21
12 0.21
13 0.21
14 0.2
15 0.19
16 0.2
17 0.21
18 0.18
19 0.19
20 0.21
21 0.22
22 0.23
23 0.22
24 0.21
25 0.17
26 0.15
27 0.11
28 0.09
29 0.1
30 0.13
31 0.13
32 0.17
33 0.18
34 0.2
35 0.28
36 0.38
37 0.44
38 0.51
39 0.6
40 0.68
41 0.76
42 0.82
43 0.84
44 0.86
45 0.86
46 0.86
47 0.86
48 0.8
49 0.78
50 0.77
51 0.71
52 0.68
53 0.6