Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PIF7

Protein Details
Accession J3PIF7   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-35VSEAPRICRKPPRKYRDPQTGQQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 11
Family & Domain DBs
Amino Acid Sequences MAGKISDDTTTQVSEAPRICRKPPRKYRDPQTGQQISTQGPFLPAFVAENGIRHDPAQTGMHADYAAFSAPFID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.26
4 0.31
5 0.34
6 0.39
7 0.46
8 0.55
9 0.62
10 0.69
11 0.72
12 0.75
13 0.81
14 0.85
15 0.86
16 0.83
17 0.78
18 0.77
19 0.72
20 0.63
21 0.55
22 0.47
23 0.36
24 0.3
25 0.25
26 0.14
27 0.12
28 0.11
29 0.09
30 0.07
31 0.07
32 0.07
33 0.07
34 0.09
35 0.08
36 0.09
37 0.11
38 0.12
39 0.13
40 0.12
41 0.13
42 0.11
43 0.14
44 0.15
45 0.13
46 0.15
47 0.15
48 0.16
49 0.15
50 0.14
51 0.11
52 0.1
53 0.11
54 0.07