Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6SFE3

Protein Details
Accession A0A2J6SFE3    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20PNSTQKKRKGWPRPPISIPGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.833, mito 13, nucl 12.5, cyto_nucl 7.666
Family & Domain DBs
Amino Acid Sequences PNSTQKKRKGWPRPPISIPGTHTSKNLRLRVNSGSNYASGKRIWLAAYHKTPKGASTRSLILIRRRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.71
4 0.64
5 0.58
6 0.54
7 0.49
8 0.42
9 0.4
10 0.36
11 0.4
12 0.43
13 0.44
14 0.41
15 0.38
16 0.4
17 0.43
18 0.44
19 0.38
20 0.32
21 0.28
22 0.25
23 0.25
24 0.22
25 0.18
26 0.13
27 0.13
28 0.11
29 0.12
30 0.11
31 0.13
32 0.17
33 0.23
34 0.31
35 0.36
36 0.37
37 0.38
38 0.38
39 0.38
40 0.41
41 0.37
42 0.32
43 0.31
44 0.33
45 0.36
46 0.41
47 0.42