Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6T039

Protein Details
Accession A0A2J6T039    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
253-282GVMDPEERKRMKKREKRKRQKERLRAAGKABasic
NLS Segment(s)
PositionSequence
137-142RAKKRR
260-282RKRMKKREKRKRQKERLRAAGKA
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021641  DUF3245  
Pfam View protein in Pfam  
PF11595  DUF3245  
Amino Acid Sequences MATDEPPKSAKVSKEDFDVISNRIAVALAKRESLIKSWTASSSRPRDPEKTEAELEAEDAALFRNEPAYLGVGAPIPSHFLVSEAERNNKSLRAKFFPSKTLQASKARDAEEKAASAKRGLKDESSDEEEGRSGLGRAKKRRTQRTEPVMETGKDEVDHIGVKGGSKLLKPQAASMDQAAGVGRGDKGLPKIQATRTGEAGKSEGSNRIAKKNQDLSTSRKPEIEKEDNDPAEDVASMKGGSIQVPAILQKGGVMDPEERKRMKKREKRKRQKERLRAAGKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.44
4 0.42
5 0.39
6 0.33
7 0.29
8 0.26
9 0.2
10 0.17
11 0.17
12 0.14
13 0.15
14 0.19
15 0.18
16 0.19
17 0.2
18 0.22
19 0.24
20 0.25
21 0.24
22 0.2
23 0.21
24 0.23
25 0.26
26 0.26
27 0.29
28 0.35
29 0.4
30 0.44
31 0.48
32 0.51
33 0.54
34 0.57
35 0.61
36 0.57
37 0.55
38 0.5
39 0.44
40 0.4
41 0.34
42 0.29
43 0.21
44 0.15
45 0.09
46 0.07
47 0.07
48 0.06
49 0.06
50 0.05
51 0.06
52 0.06
53 0.06
54 0.07
55 0.08
56 0.09
57 0.09
58 0.09
59 0.09
60 0.1
61 0.09
62 0.08
63 0.09
64 0.09
65 0.09
66 0.08
67 0.08
68 0.09
69 0.12
70 0.18
71 0.19
72 0.25
73 0.25
74 0.27
75 0.27
76 0.31
77 0.33
78 0.32
79 0.35
80 0.35
81 0.41
82 0.46
83 0.47
84 0.49
85 0.48
86 0.47
87 0.46
88 0.45
89 0.45
90 0.46
91 0.47
92 0.46
93 0.46
94 0.42
95 0.4
96 0.36
97 0.35
98 0.28
99 0.25
100 0.23
101 0.2
102 0.19
103 0.19
104 0.22
105 0.2
106 0.22
107 0.22
108 0.2
109 0.21
110 0.23
111 0.25
112 0.25
113 0.24
114 0.21
115 0.2
116 0.19
117 0.16
118 0.14
119 0.1
120 0.05
121 0.08
122 0.14
123 0.2
124 0.27
125 0.35
126 0.41
127 0.5
128 0.6
129 0.65
130 0.68
131 0.72
132 0.74
133 0.73
134 0.68
135 0.63
136 0.56
137 0.48
138 0.4
139 0.31
140 0.22
141 0.15
142 0.14
143 0.1
144 0.08
145 0.08
146 0.06
147 0.07
148 0.07
149 0.07
150 0.07
151 0.08
152 0.09
153 0.09
154 0.13
155 0.15
156 0.18
157 0.18
158 0.19
159 0.22
160 0.22
161 0.23
162 0.19
163 0.16
164 0.14
165 0.14
166 0.12
167 0.08
168 0.06
169 0.06
170 0.05
171 0.05
172 0.05
173 0.07
174 0.1
175 0.13
176 0.15
177 0.17
178 0.22
179 0.23
180 0.32
181 0.35
182 0.34
183 0.33
184 0.35
185 0.33
186 0.29
187 0.28
188 0.2
189 0.17
190 0.17
191 0.18
192 0.19
193 0.24
194 0.25
195 0.32
196 0.36
197 0.38
198 0.44
199 0.49
200 0.49
201 0.51
202 0.52
203 0.53
204 0.58
205 0.61
206 0.54
207 0.5
208 0.48
209 0.47
210 0.53
211 0.53
212 0.46
213 0.46
214 0.53
215 0.49
216 0.49
217 0.43
218 0.34
219 0.26
220 0.22
221 0.17
222 0.08
223 0.09
224 0.07
225 0.07
226 0.09
227 0.09
228 0.09
229 0.09
230 0.09
231 0.09
232 0.1
233 0.11
234 0.1
235 0.1
236 0.09
237 0.09
238 0.1
239 0.1
240 0.1
241 0.12
242 0.15
243 0.23
244 0.3
245 0.36
246 0.38
247 0.45
248 0.54
249 0.63
250 0.69
251 0.72
252 0.77
253 0.81
254 0.9
255 0.94
256 0.96
257 0.96
258 0.97
259 0.97
260 0.97
261 0.97
262 0.96