Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6T9S2

Protein Details
Accession A0A2J6T9S2    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
236-258FSNNQSYCKHCNKKGHIEDKCFIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 8, mito 2
Family & Domain DBs
Pfam View protein in Pfam  
PF14223  Retrotran_gag_2  
Amino Acid Sequences MSNTSISSFKGDKLVGSSNFIEWKTNADLFLEINGYMSYIDGTEAIPNRSLYYKIETKSDKEGKESRTWTPLSAELAARYADRVSEFNRNNKRALGALKSIISINNNDRFKDKADAEDLYKAIITTFGQSSLELIGRYFNKIVDNNYNSFNSMDEYTSNIQSSIIYLRELGQIIPDPIIVWLVLKGLPGSYNNYASRKYEELTDSLKAINIGKLITDLISEEGRLTSNLEANKASFSNNQSYCKHCNKKGHIEDKCFIKYPELRNNYSSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.31
4 0.31
5 0.28
6 0.32
7 0.32
8 0.3
9 0.23
10 0.26
11 0.26
12 0.26
13 0.24
14 0.21
15 0.21
16 0.18
17 0.2
18 0.16
19 0.11
20 0.1
21 0.1
22 0.09
23 0.08
24 0.08
25 0.06
26 0.05
27 0.06
28 0.05
29 0.06
30 0.1
31 0.12
32 0.14
33 0.15
34 0.16
35 0.17
36 0.18
37 0.19
38 0.18
39 0.22
40 0.27
41 0.26
42 0.33
43 0.35
44 0.36
45 0.45
46 0.5
47 0.44
48 0.45
49 0.5
50 0.48
51 0.53
52 0.53
53 0.46
54 0.45
55 0.45
56 0.39
57 0.35
58 0.33
59 0.27
60 0.26
61 0.23
62 0.17
63 0.18
64 0.17
65 0.14
66 0.12
67 0.1
68 0.08
69 0.09
70 0.1
71 0.12
72 0.21
73 0.25
74 0.33
75 0.43
76 0.44
77 0.44
78 0.43
79 0.41
80 0.35
81 0.35
82 0.3
83 0.23
84 0.23
85 0.22
86 0.22
87 0.21
88 0.18
89 0.16
90 0.15
91 0.18
92 0.23
93 0.24
94 0.24
95 0.25
96 0.26
97 0.27
98 0.3
99 0.25
100 0.2
101 0.22
102 0.23
103 0.23
104 0.23
105 0.21
106 0.15
107 0.15
108 0.12
109 0.09
110 0.08
111 0.07
112 0.06
113 0.06
114 0.07
115 0.07
116 0.07
117 0.07
118 0.07
119 0.08
120 0.06
121 0.06
122 0.08
123 0.08
124 0.1
125 0.1
126 0.1
127 0.12
128 0.13
129 0.16
130 0.2
131 0.23
132 0.23
133 0.25
134 0.24
135 0.23
136 0.22
137 0.19
138 0.13
139 0.11
140 0.1
141 0.08
142 0.11
143 0.12
144 0.13
145 0.13
146 0.11
147 0.1
148 0.1
149 0.1
150 0.09
151 0.08
152 0.07
153 0.08
154 0.09
155 0.1
156 0.11
157 0.1
158 0.09
159 0.09
160 0.1
161 0.09
162 0.08
163 0.07
164 0.06
165 0.07
166 0.06
167 0.05
168 0.04
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.07
175 0.08
176 0.12
177 0.14
178 0.19
179 0.22
180 0.24
181 0.26
182 0.27
183 0.3
184 0.27
185 0.25
186 0.24
187 0.23
188 0.24
189 0.26
190 0.25
191 0.22
192 0.2
193 0.2
194 0.17
195 0.16
196 0.14
197 0.12
198 0.11
199 0.1
200 0.1
201 0.1
202 0.09
203 0.08
204 0.07
205 0.08
206 0.09
207 0.09
208 0.08
209 0.09
210 0.09
211 0.09
212 0.1
213 0.1
214 0.14
215 0.15
216 0.16
217 0.17
218 0.17
219 0.19
220 0.18
221 0.19
222 0.2
223 0.23
224 0.31
225 0.34
226 0.39
227 0.4
228 0.45
229 0.5
230 0.57
231 0.61
232 0.6
233 0.66
234 0.69
235 0.77
236 0.82
237 0.85
238 0.83
239 0.82
240 0.8
241 0.77
242 0.73
243 0.65
244 0.56
245 0.53
246 0.52
247 0.53
248 0.58
249 0.57
250 0.56
251 0.56