Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6T7C4

Protein Details
Accession A0A2J6T7C4    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MARSKSKKIEKPPPLVGKKRQRKPTAKASSAHydrophilic
NLS Segment(s)
PositionSequence
4-40SKSKKIEKPPPLVGKKRQRKPTAKASSALVAPKQPKI
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MARSKSKKIEKPPPLVGKKRQRKPTAKASSALVAPKQPKIKLTTASRPPKEPSPDTGASGANPQRERTIEISSSSSSESPEPEAKTHVVTVNWQVYLNHKLVYSESFQEDFLSILYNGYRFWQGWTDKEIKARRKWKGIYGALSNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.84
4 0.84
5 0.85
6 0.86
7 0.86
8 0.86
9 0.86
10 0.85
11 0.86
12 0.85
13 0.78
14 0.71
15 0.63
16 0.56
17 0.49
18 0.44
19 0.34
20 0.29
21 0.28
22 0.32
23 0.34
24 0.32
25 0.32
26 0.35
27 0.38
28 0.4
29 0.45
30 0.48
31 0.53
32 0.62
33 0.61
34 0.59
35 0.59
36 0.58
37 0.57
38 0.5
39 0.45
40 0.42
41 0.41
42 0.39
43 0.37
44 0.31
45 0.24
46 0.27
47 0.24
48 0.21
49 0.21
50 0.2
51 0.2
52 0.2
53 0.23
54 0.2
55 0.21
56 0.17
57 0.18
58 0.19
59 0.18
60 0.18
61 0.15
62 0.13
63 0.11
64 0.1
65 0.1
66 0.11
67 0.14
68 0.14
69 0.14
70 0.16
71 0.16
72 0.16
73 0.17
74 0.16
75 0.13
76 0.13
77 0.17
78 0.17
79 0.17
80 0.16
81 0.15
82 0.17
83 0.21
84 0.2
85 0.17
86 0.14
87 0.15
88 0.15
89 0.17
90 0.16
91 0.15
92 0.17
93 0.16
94 0.16
95 0.17
96 0.16
97 0.13
98 0.11
99 0.11
100 0.08
101 0.08
102 0.09
103 0.08
104 0.08
105 0.1
106 0.12
107 0.1
108 0.13
109 0.19
110 0.21
111 0.24
112 0.3
113 0.33
114 0.34
115 0.42
116 0.48
117 0.5
118 0.58
119 0.65
120 0.67
121 0.72
122 0.74
123 0.74
124 0.76
125 0.74
126 0.71