Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PA92

Protein Details
Accession J3PA92    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
40-65DLSPHAPLRNPRRRRRPLSQRHSTLPHydrophilic
NLS Segment(s)
PositionSequence
49-55NPRRRRR
Subcellular Location(s) mito 12, nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MTPPLADRALHHARANSQPQGGTSGWRLECAWATVDLSPDLSPHAPLRNPRRRRRPLSQRHSTLPGAVCGAEMWVGRAVLQEVWLAGEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.4
4 0.36
5 0.33
6 0.31
7 0.33
8 0.29
9 0.23
10 0.2
11 0.22
12 0.21
13 0.21
14 0.21
15 0.18
16 0.18
17 0.17
18 0.16
19 0.1
20 0.11
21 0.1
22 0.11
23 0.1
24 0.1
25 0.09
26 0.08
27 0.09
28 0.08
29 0.08
30 0.08
31 0.11
32 0.12
33 0.19
34 0.29
35 0.38
36 0.48
37 0.57
38 0.66
39 0.74
40 0.8
41 0.85
42 0.85
43 0.86
44 0.87
45 0.87
46 0.82
47 0.77
48 0.74
49 0.63
50 0.56
51 0.46
52 0.37
53 0.28
54 0.22
55 0.18
56 0.12
57 0.12
58 0.09
59 0.08
60 0.08
61 0.09
62 0.09
63 0.09
64 0.1
65 0.11
66 0.09
67 0.1
68 0.09
69 0.08