Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3P378

Protein Details
Accession J3P378    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
454-481AGLLAFAFLRRRRRRRRRLELASSTHSAHydrophilic
515-537EMPGSSRPYYPRRKEDPNNVFAGHydrophilic
NLS Segment(s)
PositionSequence
463-471RRRRRRRRR
Subcellular Location(s) plas 6extr 6, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015915  Kelch-typ_b-propeller  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF13854  Kelch_5  
CDD cd21699  JMTM_APP_like  
Amino Acid Sequences MAEPFPGFLRWSMPSVTILGDYLYVDGGEVSRLIDGQVQEPPSTQVNSTLSLSLKSSWTNSTAKWTETSRAGVPKLVKTGFWPDPRTKSFYQWAGSMVYNAIPPPNQLWRFAADGAGRGSWAEVAVPDAVGFGALVKPAACASAWGADRVGYCVSGWLDKATDTTGSRRIGIPGMVTLDMETTTFKNVSTDGLKDRGIAIESHAQSVPFGPRANSSGLLALFGGMDYDSPQFSFSNLSIYDPEQGRWHWQTTTGSRPTGRERFCHVGAAGDNGTYEIFLYGGIQADPKTTWDDVHILSLPGFVFFKAPESALSSSRCDHACAADGRQMISVGGAACSVGFPKSLTEPDPWRQALGVYDMTDLEWKAGFDGTRPAYRTPQVVKDWYAQGGQRAVSWSSDAMQRLFSPETRPDSPPGTPLNTPGSADGQATPASGLSAGATAGIAVGAVAGALIIAGLLAFAFLRRRRRRRRRLELASSTHSAKCMAAACHEIQGASFYELQAPTAELQCHTIMPFEMPGSSRPYYPRRKEDPNNVFAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.21
4 0.17
5 0.15
6 0.13
7 0.12
8 0.11
9 0.1
10 0.08
11 0.07
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.07
21 0.1
22 0.11
23 0.13
24 0.18
25 0.19
26 0.2
27 0.2
28 0.23
29 0.22
30 0.23
31 0.21
32 0.22
33 0.23
34 0.25
35 0.26
36 0.26
37 0.23
38 0.23
39 0.24
40 0.2
41 0.2
42 0.19
43 0.2
44 0.19
45 0.23
46 0.25
47 0.24
48 0.32
49 0.32
50 0.32
51 0.33
52 0.34
53 0.34
54 0.35
55 0.37
56 0.33
57 0.36
58 0.36
59 0.37
60 0.38
61 0.37
62 0.4
63 0.37
64 0.33
65 0.3
66 0.37
67 0.4
68 0.43
69 0.45
70 0.45
71 0.53
72 0.57
73 0.6
74 0.54
75 0.53
76 0.53
77 0.53
78 0.49
79 0.42
80 0.39
81 0.35
82 0.33
83 0.27
84 0.21
85 0.16
86 0.14
87 0.13
88 0.13
89 0.1
90 0.11
91 0.14
92 0.22
93 0.23
94 0.24
95 0.26
96 0.27
97 0.29
98 0.28
99 0.28
100 0.2
101 0.21
102 0.2
103 0.18
104 0.15
105 0.12
106 0.12
107 0.09
108 0.08
109 0.06
110 0.04
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.05
117 0.05
118 0.05
119 0.04
120 0.04
121 0.04
122 0.05
123 0.05
124 0.05
125 0.05
126 0.06
127 0.05
128 0.06
129 0.07
130 0.13
131 0.13
132 0.13
133 0.14
134 0.14
135 0.15
136 0.16
137 0.15
138 0.09
139 0.09
140 0.1
141 0.11
142 0.11
143 0.11
144 0.1
145 0.1
146 0.1
147 0.1
148 0.09
149 0.11
150 0.11
151 0.14
152 0.19
153 0.2
154 0.21
155 0.21
156 0.22
157 0.21
158 0.2
159 0.17
160 0.12
161 0.13
162 0.12
163 0.11
164 0.09
165 0.08
166 0.08
167 0.07
168 0.07
169 0.06
170 0.08
171 0.08
172 0.08
173 0.08
174 0.08
175 0.11
176 0.12
177 0.14
178 0.15
179 0.18
180 0.18
181 0.17
182 0.18
183 0.16
184 0.15
185 0.12
186 0.12
187 0.17
188 0.17
189 0.19
190 0.18
191 0.17
192 0.16
193 0.18
194 0.17
195 0.12
196 0.12
197 0.11
198 0.12
199 0.15
200 0.16
201 0.15
202 0.13
203 0.13
204 0.13
205 0.12
206 0.11
207 0.09
208 0.07
209 0.06
210 0.05
211 0.03
212 0.03
213 0.04
214 0.05
215 0.05
216 0.05
217 0.07
218 0.06
219 0.07
220 0.09
221 0.08
222 0.1
223 0.1
224 0.11
225 0.11
226 0.12
227 0.16
228 0.15
229 0.15
230 0.14
231 0.14
232 0.18
233 0.19
234 0.2
235 0.16
236 0.19
237 0.22
238 0.23
239 0.31
240 0.28
241 0.28
242 0.28
243 0.3
244 0.34
245 0.38
246 0.36
247 0.31
248 0.34
249 0.37
250 0.36
251 0.35
252 0.28
253 0.23
254 0.21
255 0.21
256 0.15
257 0.1
258 0.09
259 0.08
260 0.08
261 0.06
262 0.05
263 0.03
264 0.03
265 0.03
266 0.03
267 0.03
268 0.04
269 0.04
270 0.05
271 0.05
272 0.06
273 0.06
274 0.07
275 0.09
276 0.09
277 0.09
278 0.1
279 0.12
280 0.11
281 0.13
282 0.13
283 0.1
284 0.1
285 0.11
286 0.09
287 0.08
288 0.08
289 0.06
290 0.06
291 0.06
292 0.08
293 0.08
294 0.08
295 0.08
296 0.12
297 0.13
298 0.16
299 0.18
300 0.17
301 0.17
302 0.2
303 0.2
304 0.17
305 0.16
306 0.14
307 0.16
308 0.16
309 0.17
310 0.18
311 0.18
312 0.17
313 0.17
314 0.16
315 0.12
316 0.11
317 0.1
318 0.06
319 0.06
320 0.05
321 0.04
322 0.04
323 0.04
324 0.05
325 0.04
326 0.04
327 0.04
328 0.06
329 0.08
330 0.1
331 0.12
332 0.16
333 0.21
334 0.25
335 0.31
336 0.3
337 0.28
338 0.26
339 0.25
340 0.22
341 0.2
342 0.17
343 0.12
344 0.12
345 0.12
346 0.12
347 0.12
348 0.11
349 0.08
350 0.07
351 0.06
352 0.07
353 0.08
354 0.08
355 0.08
356 0.14
357 0.16
358 0.19
359 0.22
360 0.23
361 0.26
362 0.28
363 0.32
364 0.3
365 0.34
366 0.35
367 0.36
368 0.37
369 0.37
370 0.37
371 0.33
372 0.31
373 0.25
374 0.24
375 0.23
376 0.2
377 0.17
378 0.18
379 0.17
380 0.15
381 0.15
382 0.12
383 0.12
384 0.15
385 0.16
386 0.14
387 0.15
388 0.14
389 0.17
390 0.19
391 0.18
392 0.19
393 0.23
394 0.29
395 0.32
396 0.34
397 0.34
398 0.36
399 0.35
400 0.36
401 0.34
402 0.32
403 0.28
404 0.29
405 0.31
406 0.28
407 0.28
408 0.24
409 0.23
410 0.2
411 0.2
412 0.18
413 0.14
414 0.13
415 0.13
416 0.11
417 0.09
418 0.08
419 0.07
420 0.06
421 0.05
422 0.05
423 0.05
424 0.04
425 0.04
426 0.04
427 0.04
428 0.03
429 0.03
430 0.02
431 0.02
432 0.02
433 0.02
434 0.02
435 0.02
436 0.02
437 0.01
438 0.01
439 0.01
440 0.01
441 0.01
442 0.01
443 0.02
444 0.02
445 0.02
446 0.03
447 0.1
448 0.15
449 0.27
450 0.38
451 0.49
452 0.61
453 0.72
454 0.83
455 0.88
456 0.94
457 0.95
458 0.95
459 0.95
460 0.93
461 0.89
462 0.84
463 0.76
464 0.69
465 0.58
466 0.48
467 0.38
468 0.29
469 0.24
470 0.23
471 0.2
472 0.2
473 0.23
474 0.24
475 0.25
476 0.26
477 0.22
478 0.18
479 0.19
480 0.17
481 0.15
482 0.15
483 0.12
484 0.17
485 0.17
486 0.18
487 0.16
488 0.16
489 0.15
490 0.18
491 0.19
492 0.15
493 0.18
494 0.18
495 0.19
496 0.18
497 0.17
498 0.15
499 0.15
500 0.16
501 0.14
502 0.15
503 0.15
504 0.17
505 0.22
506 0.23
507 0.24
508 0.3
509 0.39
510 0.48
511 0.57
512 0.64
513 0.66
514 0.75
515 0.82
516 0.86
517 0.87