Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6SU69

Protein Details
Accession A0A2J6SU69    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-21APRSYSKTAKVPRRPFESARHydrophilic
159-185SSPFGGGRPGRVRRKKAKAAEKKDGGDBasic
NLS Segment(s)
PositionSequence
165-181GRPGRVRRKKAKAAEKK
Subcellular Location(s) nucl 12, mito 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022801  Ribosomal_S4/S9  
IPR005710  Ribosomal_S4/S9_euk/arc  
IPR001912  Ribosomal_S4/S9_N  
IPR018079  Ribosomal_S4_CS  
IPR002942  S4_RNA-bd  
IPR036986  S4_RNA-bd_sf  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00163  Ribosomal_S4  
PF01479  S4  
PROSITE View protein in PROSITE  
PS00632  RIBOSOMAL_S4  
PS50889  S4  
CDD cd00165  S4  
Amino Acid Sequences MAPRSYSKTAKVPRRPFESARLDSELKLVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEKDPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALSSPFGGGRPGRVRRKKAKAAEKKDGGDDAEDEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.74
4 0.74
5 0.73
6 0.67
7 0.62
8 0.59
9 0.52
10 0.46
11 0.44
12 0.36
13 0.27
14 0.22
15 0.17
16 0.12
17 0.12
18 0.14
19 0.21
20 0.26
21 0.27
22 0.28
23 0.31
24 0.38
25 0.43
26 0.46
27 0.45
28 0.45
29 0.46
30 0.48
31 0.49
32 0.46
33 0.47
34 0.46
35 0.43
36 0.39
37 0.41
38 0.43
39 0.43
40 0.47
41 0.42
42 0.45
43 0.42
44 0.43
45 0.44
46 0.4
47 0.37
48 0.36
49 0.32
50 0.32
51 0.32
52 0.28
53 0.26
54 0.28
55 0.27
56 0.26
57 0.32
58 0.33
59 0.38
60 0.37
61 0.34
62 0.32
63 0.31
64 0.25
65 0.18
66 0.12
67 0.07
68 0.08
69 0.1
70 0.1
71 0.11
72 0.12
73 0.12
74 0.12
75 0.12
76 0.1
77 0.08
78 0.07
79 0.09
80 0.09
81 0.09
82 0.08
83 0.08
84 0.08
85 0.09
86 0.09
87 0.07
88 0.07
89 0.08
90 0.13
91 0.13
92 0.14
93 0.14
94 0.16
95 0.16
96 0.17
97 0.18
98 0.14
99 0.16
100 0.16
101 0.16
102 0.21
103 0.21
104 0.21
105 0.25
106 0.3
107 0.28
108 0.28
109 0.27
110 0.22
111 0.31
112 0.39
113 0.37
114 0.37
115 0.42
116 0.44
117 0.52
118 0.54
119 0.49
120 0.47
121 0.5
122 0.49
123 0.47
124 0.5
125 0.45
126 0.43
127 0.39
128 0.32
129 0.25
130 0.2
131 0.16
132 0.14
133 0.11
134 0.14
135 0.17
136 0.21
137 0.24
138 0.25
139 0.25
140 0.23
141 0.23
142 0.2
143 0.17
144 0.2
145 0.16
146 0.15
147 0.14
148 0.14
149 0.14
150 0.17
151 0.16
152 0.17
153 0.25
154 0.35
155 0.45
156 0.54
157 0.64
158 0.71
159 0.81
160 0.84
161 0.86
162 0.88
163 0.88
164 0.88
165 0.9
166 0.87
167 0.79
168 0.73
169 0.65
170 0.55
171 0.46
172 0.37
173 0.3