Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6TCD6

Protein Details
Accession A0A2J6TCD6    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
65-89ELEEAKKEEKKREKKEKNQDSGEDNAcidic
NLS Segment(s)
PositionSequence
70-80KKEEKKREKKE
Subcellular Location(s) mito 23, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008906  HATC_C_dom  
IPR012337  RNaseH-like_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF05699  Dimer_Tnp_hAT  
Amino Acid Sequences KSNAARFPVLALIARKYLGIPASSAASERFFSQGALIISKLRNRLNKSTFEIISCLKSWGLFQDELEEAKKEEKKREKKEKNQDSGEDNQFIIIEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.16
4 0.17
5 0.15
6 0.13
7 0.11
8 0.11
9 0.12
10 0.12
11 0.13
12 0.12
13 0.11
14 0.11
15 0.12
16 0.12
17 0.1
18 0.1
19 0.1
20 0.13
21 0.11
22 0.12
23 0.11
24 0.12
25 0.13
26 0.16
27 0.2
28 0.2
29 0.25
30 0.29
31 0.37
32 0.38
33 0.42
34 0.44
35 0.44
36 0.4
37 0.35
38 0.32
39 0.25
40 0.24
41 0.2
42 0.16
43 0.11
44 0.11
45 0.11
46 0.11
47 0.14
48 0.12
49 0.11
50 0.14
51 0.15
52 0.16
53 0.17
54 0.15
55 0.12
56 0.18
57 0.23
58 0.24
59 0.33
60 0.43
61 0.52
62 0.63
63 0.73
64 0.79
65 0.84
66 0.92
67 0.93
68 0.92
69 0.89
70 0.82
71 0.76
72 0.74
73 0.68
74 0.59
75 0.48
76 0.38