Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6SGX3

Protein Details
Accession A0A2J6SGX3    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
106-132LREKLSQKAKWPQKKEKVEKSLRAIVKHydrophilic
NLS Segment(s)
PositionSequence
117-121PQKKE
Subcellular Location(s) nucl 14.5, mito_nucl 9, cyto 8, mito 2.5
Family & Domain DBs
Amino Acid Sequences MADPINAAIKTVAAVTTQAYDYGSKVKHAKEDIENVNRELVQVGQVLEKLKALAERAEKAEKAGQSGQSLDAWPTLIELNADDGPLAKCNQSLLDLKSELAPVSSLREKLSQKAKWPQKKEKVEKSLRAIVKEKNVFLEMLNVDHISKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.1
4 0.1
5 0.1
6 0.1
7 0.1
8 0.11
9 0.17
10 0.17
11 0.19
12 0.23
13 0.25
14 0.3
15 0.32
16 0.36
17 0.35
18 0.43
19 0.47
20 0.5
21 0.49
22 0.44
23 0.43
24 0.38
25 0.33
26 0.25
27 0.17
28 0.11
29 0.1
30 0.1
31 0.09
32 0.1
33 0.11
34 0.11
35 0.11
36 0.09
37 0.09
38 0.09
39 0.09
40 0.12
41 0.14
42 0.16
43 0.19
44 0.21
45 0.21
46 0.21
47 0.24
48 0.2
49 0.21
50 0.21
51 0.19
52 0.17
53 0.18
54 0.17
55 0.14
56 0.14
57 0.11
58 0.09
59 0.07
60 0.06
61 0.06
62 0.05
63 0.05
64 0.05
65 0.04
66 0.06
67 0.06
68 0.06
69 0.05
70 0.06
71 0.07
72 0.08
73 0.09
74 0.07
75 0.07
76 0.07
77 0.08
78 0.1
79 0.13
80 0.13
81 0.16
82 0.16
83 0.16
84 0.17
85 0.17
86 0.14
87 0.11
88 0.1
89 0.07
90 0.11
91 0.14
92 0.14
93 0.15
94 0.21
95 0.23
96 0.29
97 0.38
98 0.36
99 0.42
100 0.51
101 0.6
102 0.64
103 0.72
104 0.76
105 0.78
106 0.85
107 0.88
108 0.88
109 0.88
110 0.88
111 0.87
112 0.83
113 0.82
114 0.74
115 0.69
116 0.63
117 0.58
118 0.58
119 0.55
120 0.49
121 0.43
122 0.41
123 0.36
124 0.32
125 0.33
126 0.24
127 0.2
128 0.21
129 0.18
130 0.17