Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6TSH1

Protein Details
Accession A0A2J6TSH1    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
69-102SQSQVPREKEKEKRAKKQKEQQKRAEQKKLESGEHydrophilic
NLS Segment(s)
PositionSequence
75-97REKEKEKRAKKQKEQQKRAEQKK
Subcellular Location(s) mito 16, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MATPSFNRRAAGLKSIGAKRFLAEDYARAPGALKTLLGDEYIIGDGVKLLAKMQGLRPLKQNTKDRTESQSQVPREKEKEKRAKKQKEQQKRAEQKKLESGENKNAAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.4
3 0.41
4 0.38
5 0.35
6 0.29
7 0.3
8 0.27
9 0.23
10 0.19
11 0.18
12 0.18
13 0.2
14 0.19
15 0.17
16 0.17
17 0.13
18 0.14
19 0.12
20 0.1
21 0.08
22 0.09
23 0.09
24 0.08
25 0.08
26 0.06
27 0.06
28 0.06
29 0.06
30 0.05
31 0.04
32 0.04
33 0.04
34 0.05
35 0.04
36 0.04
37 0.05
38 0.06
39 0.07
40 0.08
41 0.16
42 0.18
43 0.19
44 0.25
45 0.3
46 0.35
47 0.42
48 0.49
49 0.46
50 0.52
51 0.55
52 0.52
53 0.52
54 0.52
55 0.47
56 0.47
57 0.49
58 0.45
59 0.48
60 0.48
61 0.48
62 0.48
63 0.54
64 0.55
65 0.58
66 0.66
67 0.7
68 0.77
69 0.82
70 0.87
71 0.9
72 0.91
73 0.91
74 0.92
75 0.92
76 0.92
77 0.92
78 0.92
79 0.91
80 0.91
81 0.86
82 0.81
83 0.8
84 0.74
85 0.71
86 0.67
87 0.64
88 0.64