Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6TCN5

Protein Details
Accession A0A2J6TCN5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
8-35PTSPLTPINRRYNSRRRRRRGMAPMYGTHydrophilic
NLS Segment(s)
PositionSequence
22-27RRRRRR
Subcellular Location(s) mito 15, nucl 8, cyto 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020999  Chitin_synth_reg_RCR  
Pfam View protein in Pfam  
PF12273  RCR  
Amino Acid Sequences MFLSSLPPTSPLTPINRRYNSRRRRRRGMAPMYGTGWMGGNWSHKPPVGQQYGNNGGYYPNQPYNGGAAPPYEPPIPNQATGTTFNSNDGYYGHNAYELQQPQNSYQPQRGGDPVYDAPQGPPPKKGDGIIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.54
3 0.58
4 0.62
5 0.69
6 0.75
7 0.78
8 0.8
9 0.83
10 0.82
11 0.86
12 0.88
13 0.89
14 0.89
15 0.88
16 0.86
17 0.79
18 0.72
19 0.63
20 0.55
21 0.44
22 0.33
23 0.24
24 0.14
25 0.1
26 0.09
27 0.11
28 0.12
29 0.14
30 0.14
31 0.15
32 0.16
33 0.19
34 0.27
35 0.29
36 0.29
37 0.29
38 0.34
39 0.4
40 0.4
41 0.35
42 0.27
43 0.22
44 0.22
45 0.22
46 0.18
47 0.14
48 0.14
49 0.14
50 0.14
51 0.16
52 0.15
53 0.13
54 0.1
55 0.09
56 0.09
57 0.09
58 0.11
59 0.1
60 0.09
61 0.11
62 0.17
63 0.18
64 0.17
65 0.18
66 0.17
67 0.18
68 0.21
69 0.23
70 0.19
71 0.18
72 0.19
73 0.19
74 0.18
75 0.16
76 0.13
77 0.12
78 0.12
79 0.13
80 0.11
81 0.11
82 0.11
83 0.13
84 0.2
85 0.2
86 0.21
87 0.21
88 0.23
89 0.24
90 0.32
91 0.34
92 0.31
93 0.33
94 0.36
95 0.36
96 0.37
97 0.38
98 0.34
99 0.3
100 0.32
101 0.28
102 0.27
103 0.26
104 0.24
105 0.22
106 0.28
107 0.35
108 0.31
109 0.35
110 0.35
111 0.39
112 0.41