Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6TF95

Protein Details
Accession A0A2J6TF95    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
215-234LPRGRPKKPDSEKKVKVPSGBasic
254-279AKAASGETKKRGRKPKAKEEEVKGEABasic
NLS Segment(s)
PositionSequence
206-271PKPKKVSSGLPRGRPKKPDSEKKVKVPSGRGRGRPPKVITAEEKAAMAAKAASGETKKRGRKPKAK
296-315KKRKTSEGPASSAKRSGKKA
Subcellular Location(s) nucl 13, cyto_nucl 12.833, cyto 9.5, mito_nucl 9.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MAETIDAKSFKDALDRYPALIKSLSKPPKEGQLSLEELDAFRYNGAPMAYSSKTGRTMESKDLQKLFEWKMRHGVFRPGLSGKVASNSNETIAAAFKDGFVYYAEKPSDIAGVLEKLSKPLKGVGPATASLLLAVHDPSNVVFFSDELYRWLLHDGKKVSPKYTAKEFEELFNKAKSFMSRIKCTPIELEKAAFVIIKENEPVPEPKPKKVSSGLPRGRPKKPDSEKKVKVPSGRGRGRPPKVITAEEKAAMAAKAASGETKKRGRKPKAKEEEVKGEADVEAGEVEETAATPASKKRKTSEGPASSAKRSGKKAMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.32
4 0.38
5 0.38
6 0.33
7 0.35
8 0.33
9 0.29
10 0.39
11 0.45
12 0.41
13 0.45
14 0.45
15 0.52
16 0.55
17 0.51
18 0.45
19 0.43
20 0.44
21 0.4
22 0.39
23 0.29
24 0.24
25 0.24
26 0.21
27 0.15
28 0.11
29 0.11
30 0.1
31 0.12
32 0.12
33 0.1
34 0.1
35 0.16
36 0.16
37 0.18
38 0.2
39 0.21
40 0.25
41 0.25
42 0.27
43 0.28
44 0.31
45 0.36
46 0.43
47 0.45
48 0.47
49 0.48
50 0.45
51 0.42
52 0.44
53 0.41
54 0.39
55 0.36
56 0.32
57 0.39
58 0.41
59 0.43
60 0.39
61 0.43
62 0.42
63 0.41
64 0.42
65 0.34
66 0.33
67 0.29
68 0.28
69 0.19
70 0.19
71 0.19
72 0.17
73 0.18
74 0.18
75 0.17
76 0.16
77 0.16
78 0.12
79 0.12
80 0.11
81 0.08
82 0.08
83 0.07
84 0.07
85 0.07
86 0.08
87 0.08
88 0.11
89 0.11
90 0.16
91 0.16
92 0.15
93 0.16
94 0.15
95 0.15
96 0.12
97 0.11
98 0.07
99 0.08
100 0.08
101 0.1
102 0.09
103 0.11
104 0.12
105 0.12
106 0.12
107 0.15
108 0.17
109 0.19
110 0.2
111 0.19
112 0.2
113 0.2
114 0.2
115 0.17
116 0.15
117 0.11
118 0.1
119 0.07
120 0.06
121 0.06
122 0.05
123 0.04
124 0.05
125 0.05
126 0.06
127 0.05
128 0.05
129 0.05
130 0.05
131 0.06
132 0.07
133 0.07
134 0.07
135 0.09
136 0.08
137 0.09
138 0.1
139 0.12
140 0.13
141 0.18
142 0.19
143 0.22
144 0.29
145 0.3
146 0.3
147 0.34
148 0.35
149 0.34
150 0.39
151 0.4
152 0.35
153 0.38
154 0.37
155 0.33
156 0.34
157 0.32
158 0.27
159 0.24
160 0.22
161 0.19
162 0.19
163 0.17
164 0.18
165 0.22
166 0.27
167 0.29
168 0.31
169 0.36
170 0.35
171 0.35
172 0.35
173 0.31
174 0.29
175 0.26
176 0.25
177 0.19
178 0.19
179 0.18
180 0.14
181 0.1
182 0.11
183 0.1
184 0.11
185 0.11
186 0.12
187 0.12
188 0.13
189 0.16
190 0.14
191 0.24
192 0.25
193 0.3
194 0.37
195 0.37
196 0.4
197 0.43
198 0.5
199 0.48
200 0.57
201 0.58
202 0.6
203 0.69
204 0.71
205 0.72
206 0.69
207 0.65
208 0.65
209 0.69
210 0.71
211 0.71
212 0.75
213 0.77
214 0.79
215 0.84
216 0.78
217 0.73
218 0.72
219 0.72
220 0.71
221 0.71
222 0.68
223 0.69
224 0.74
225 0.74
226 0.72
227 0.67
228 0.65
229 0.61
230 0.6
231 0.54
232 0.5
233 0.47
234 0.39
235 0.36
236 0.27
237 0.25
238 0.2
239 0.16
240 0.1
241 0.07
242 0.07
243 0.07
244 0.1
245 0.12
246 0.16
247 0.23
248 0.32
249 0.4
250 0.48
251 0.59
252 0.67
253 0.74
254 0.81
255 0.84
256 0.86
257 0.88
258 0.88
259 0.86
260 0.85
261 0.78
262 0.69
263 0.57
264 0.47
265 0.37
266 0.28
267 0.2
268 0.1
269 0.07
270 0.06
271 0.06
272 0.05
273 0.05
274 0.04
275 0.05
276 0.05
277 0.06
278 0.06
279 0.08
280 0.15
281 0.25
282 0.31
283 0.35
284 0.4
285 0.49
286 0.55
287 0.63
288 0.67
289 0.65
290 0.65
291 0.7
292 0.7
293 0.63
294 0.64
295 0.61
296 0.57
297 0.55