Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3NUM1

Protein Details
Accession J3NUM1    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
195-222TPETPPKKLSMPKRKSSRPKFFVPGKLDHydrophilic
NLS Segment(s)
PositionSequence
201-213KKLSMPKRKSSRP
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MPSFGSAQGSNGAMSAPQSDGFVWPESEPPRTRSLVSARMLTELQRTTSASPPNQLPVPLVSSAGRRGGVSIPVSPRDEQCEASSLPPAHSADRLQTSAVMRELNEQIDALLPLGKIAVEEGNVSLEETPHEVWEEISLDGDKQGTLLPRLEASGPAWPSPLRVSVSAESLDDIKLSPQQSDAPRKESEALPPLTPETPPKKLSMPKRKSSRPKFFVPGKLDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.08
5 0.09
6 0.1
7 0.12
8 0.14
9 0.15
10 0.15
11 0.14
12 0.2
13 0.21
14 0.28
15 0.29
16 0.3
17 0.33
18 0.34
19 0.34
20 0.34
21 0.39
22 0.4
23 0.4
24 0.4
25 0.36
26 0.37
27 0.36
28 0.31
29 0.29
30 0.23
31 0.22
32 0.19
33 0.2
34 0.2
35 0.25
36 0.3
37 0.26
38 0.29
39 0.29
40 0.31
41 0.3
42 0.28
43 0.23
44 0.19
45 0.2
46 0.17
47 0.17
48 0.14
49 0.15
50 0.16
51 0.17
52 0.16
53 0.13
54 0.14
55 0.14
56 0.16
57 0.16
58 0.18
59 0.18
60 0.21
61 0.23
62 0.23
63 0.22
64 0.24
65 0.24
66 0.22
67 0.21
68 0.21
69 0.19
70 0.19
71 0.23
72 0.18
73 0.16
74 0.18
75 0.18
76 0.15
77 0.16
78 0.16
79 0.14
80 0.16
81 0.16
82 0.14
83 0.15
84 0.15
85 0.15
86 0.15
87 0.13
88 0.1
89 0.13
90 0.14
91 0.12
92 0.11
93 0.09
94 0.08
95 0.08
96 0.08
97 0.05
98 0.05
99 0.05
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.03
107 0.04
108 0.04
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.06
116 0.06
117 0.06
118 0.07
119 0.07
120 0.07
121 0.08
122 0.08
123 0.07
124 0.07
125 0.07
126 0.07
127 0.07
128 0.07
129 0.06
130 0.05
131 0.06
132 0.07
133 0.09
134 0.1
135 0.1
136 0.1
137 0.11
138 0.11
139 0.11
140 0.11
141 0.14
142 0.14
143 0.14
144 0.15
145 0.14
146 0.15
147 0.16
148 0.18
149 0.15
150 0.15
151 0.19
152 0.19
153 0.21
154 0.2
155 0.19
156 0.16
157 0.15
158 0.14
159 0.1
160 0.09
161 0.08
162 0.11
163 0.12
164 0.12
165 0.12
166 0.18
167 0.26
168 0.36
169 0.38
170 0.39
171 0.39
172 0.41
173 0.44
174 0.39
175 0.38
176 0.36
177 0.35
178 0.31
179 0.32
180 0.32
181 0.29
182 0.29
183 0.3
184 0.3
185 0.33
186 0.35
187 0.36
188 0.41
189 0.48
190 0.58
191 0.62
192 0.64
193 0.68
194 0.76
195 0.84
196 0.88
197 0.91
198 0.91
199 0.86
200 0.85
201 0.84
202 0.83
203 0.81
204 0.76