Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6T0S1

Protein Details
Accession A0A2J6T0S1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-78WTKMPSTSPKKSSRHRRTQIPRRRNRSHWKHydrophilic
NLS Segment(s)
PositionSequence
57-78PKKSSRHRRTQIPRRRNRSHWK
Subcellular Location(s) plas 15, mito 5, E.R. 3, golg 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQFVVVSRYSLPHYGFYPSFSSMIALVFIFEPMFLLGPGKTNLRVRVAWTKMPSTSPKKSSRHRRTQIPRRRNRSHWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.25
4 0.25
5 0.23
6 0.22
7 0.19
8 0.18
9 0.13
10 0.13
11 0.11
12 0.08
13 0.06
14 0.06
15 0.06
16 0.05
17 0.05
18 0.05
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.06
25 0.07
26 0.08
27 0.11
28 0.13
29 0.15
30 0.17
31 0.18
32 0.21
33 0.28
34 0.31
35 0.32
36 0.33
37 0.33
38 0.31
39 0.34
40 0.38
41 0.37
42 0.41
43 0.45
44 0.51
45 0.57
46 0.66
47 0.74
48 0.77
49 0.81
50 0.82
51 0.85
52 0.87
53 0.91
54 0.91
55 0.91
56 0.91
57 0.9
58 0.91