Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6SLM4

Protein Details
Accession A0A2J6SLM4    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
108-129GLADKLKNKLFRKKVAKEEKTAHydrophilic
NLS Segment(s)
PositionSequence
116-123KLFRKKVA
Subcellular Location(s) cyto 10cyto_nucl 10, mito 9, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MSARNSTDVSHGRGGAGNIGADATPYGDGEIVREGIAGDHLDGAFSTGRGGAANIGSPGVKATERKDEMAIPEVALRPSTEGENFHVGRGGEGNVHVAEKTTTKHPEGLADKLKNKLFRKKVAKEEKTAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.22
3 0.19
4 0.14
5 0.11
6 0.11
7 0.1
8 0.08
9 0.07
10 0.06
11 0.05
12 0.05
13 0.06
14 0.06
15 0.06
16 0.07
17 0.08
18 0.08
19 0.07
20 0.07
21 0.07
22 0.06
23 0.08
24 0.07
25 0.05
26 0.06
27 0.06
28 0.06
29 0.05
30 0.07
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.07
49 0.09
50 0.17
51 0.19
52 0.2
53 0.2
54 0.2
55 0.21
56 0.23
57 0.21
58 0.13
59 0.13
60 0.13
61 0.12
62 0.11
63 0.1
64 0.08
65 0.09
66 0.09
67 0.09
68 0.1
69 0.12
70 0.18
71 0.19
72 0.18
73 0.19
74 0.18
75 0.17
76 0.17
77 0.15
78 0.09
79 0.09
80 0.11
81 0.08
82 0.09
83 0.08
84 0.08
85 0.09
86 0.1
87 0.12
88 0.16
89 0.2
90 0.22
91 0.25
92 0.25
93 0.32
94 0.34
95 0.39
96 0.42
97 0.45
98 0.47
99 0.5
100 0.55
101 0.55
102 0.59
103 0.62
104 0.61
105 0.65
106 0.72
107 0.74
108 0.81
109 0.83
110 0.83