Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GN50

Protein Details
Accession A0A2I1GN50   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKFIKKSIKRNKIYKTMNSDGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, mito_nucl 13.5, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MGKFIKKSIKRNKIYKTMNSDGKETIKKYMTEWEEKGKIIKTPFVELSIKLRDEHKLNFEPKVICDYWWNILDPRLDHSPYSKEEKNHIYEWANKYQKNGNIQWTLLQAEMETKFGKFRARNELKNIWNTKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.8
4 0.78
5 0.77
6 0.7
7 0.64
8 0.56
9 0.55
10 0.52
11 0.44
12 0.41
13 0.37
14 0.35
15 0.34
16 0.39
17 0.37
18 0.38
19 0.39
20 0.41
21 0.39
22 0.39
23 0.41
24 0.33
25 0.32
26 0.27
27 0.29
28 0.23
29 0.25
30 0.25
31 0.26
32 0.25
33 0.22
34 0.26
35 0.25
36 0.24
37 0.21
38 0.21
39 0.21
40 0.23
41 0.24
42 0.25
43 0.28
44 0.29
45 0.29
46 0.31
47 0.29
48 0.26
49 0.29
50 0.23
51 0.17
52 0.17
53 0.17
54 0.17
55 0.17
56 0.18
57 0.13
58 0.15
59 0.16
60 0.15
61 0.17
62 0.17
63 0.17
64 0.17
65 0.19
66 0.2
67 0.21
68 0.28
69 0.28
70 0.26
71 0.31
72 0.36
73 0.39
74 0.36
75 0.37
76 0.33
77 0.37
78 0.4
79 0.45
80 0.45
81 0.41
82 0.43
83 0.46
84 0.47
85 0.47
86 0.46
87 0.43
88 0.4
89 0.4
90 0.39
91 0.35
92 0.31
93 0.24
94 0.2
95 0.13
96 0.14
97 0.15
98 0.15
99 0.14
100 0.13
101 0.14
102 0.16
103 0.24
104 0.24
105 0.29
106 0.39
107 0.47
108 0.53
109 0.6
110 0.67
111 0.66
112 0.71