Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HK94

Protein Details
Accession A0A2I1HK94   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MIKSVSVKCKQNRQSNNNKKKSKKTIVIDSNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MIKSVSVKCKQNRQSNNNKKKSKKTIVIDSNIEEDCENSNYKEDNKENELVLKLKELEYREKDLALKNKRQLNLAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.9
4 0.89
5 0.89
6 0.87
7 0.87
8 0.88
9 0.87
10 0.84
11 0.8
12 0.8
13 0.78
14 0.75
15 0.67
16 0.58
17 0.5
18 0.41
19 0.34
20 0.23
21 0.16
22 0.13
23 0.12
24 0.11
25 0.09
26 0.1
27 0.11
28 0.12
29 0.18
30 0.18
31 0.21
32 0.24
33 0.25
34 0.25
35 0.26
36 0.26
37 0.22
38 0.2
39 0.18
40 0.16
41 0.16
42 0.19
43 0.19
44 0.26
45 0.29
46 0.35
47 0.34
48 0.35
49 0.36
50 0.4
51 0.47
52 0.47
53 0.51
54 0.52
55 0.58
56 0.59