Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GAH8

Protein Details
Accession A0A2I1GAH8    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-27PSTPSQSRRRILRRLVKSRQTNRNTDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 11, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR028847  CENP-W  
IPR009072  Histone-fold  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0051382  P:kinetochore assembly  
GO:0000278  P:mitotic cell cycle  
Pfam View protein in Pfam  
PF15510  CENP-W  
Amino Acid Sequences MPSTPSQSRRRILRRLVKSRQTNRNTDNAIYNHCKLFLQTLAQEANNEAETDNTNVVEEKHVKVALEKVLHEFQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.84
4 0.84
5 0.86
6 0.86
7 0.87
8 0.82
9 0.79
10 0.73
11 0.71
12 0.64
13 0.55
14 0.51
15 0.42
16 0.42
17 0.38
18 0.36
19 0.29
20 0.26
21 0.24
22 0.18
23 0.19
24 0.14
25 0.11
26 0.1
27 0.12
28 0.13
29 0.13
30 0.13
31 0.11
32 0.12
33 0.1
34 0.1
35 0.08
36 0.07
37 0.09
38 0.1
39 0.1
40 0.09
41 0.09
42 0.09
43 0.1
44 0.14
45 0.15
46 0.15
47 0.19
48 0.19
49 0.19
50 0.21
51 0.25
52 0.26
53 0.26
54 0.26
55 0.28