Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HFF1

Protein Details
Accession A0A2I1HFF1   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MCKRRRKGKLRMKESIKYQIBasic
NLS Segment(s)
PositionSequence
3-13KRRRKGKLRMK
71-74GRPK
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MCKRRRKGKLRMKESIKYQIPKDSIAIYRISKDPCLKKFTDERRQRIFHNNNNVNVNIIGIQNPVARIPKGRPKLKSIKGALEESSNKSQYSCKICKQLGHNSKTCKGKGKENQDNSEEMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.77
4 0.71
5 0.64
6 0.62
7 0.55
8 0.49
9 0.44
10 0.38
11 0.33
12 0.29
13 0.3
14 0.23
15 0.24
16 0.27
17 0.27
18 0.27
19 0.33
20 0.38
21 0.4
22 0.44
23 0.42
24 0.43
25 0.51
26 0.57
27 0.6
28 0.62
29 0.65
30 0.67
31 0.68
32 0.67
33 0.68
34 0.66
35 0.62
36 0.64
37 0.61
38 0.56
39 0.56
40 0.52
41 0.42
42 0.34
43 0.26
44 0.16
45 0.12
46 0.08
47 0.06
48 0.07
49 0.06
50 0.07
51 0.08
52 0.08
53 0.08
54 0.1
55 0.14
56 0.22
57 0.31
58 0.37
59 0.38
60 0.45
61 0.55
62 0.6
63 0.65
64 0.59
65 0.57
66 0.55
67 0.54
68 0.47
69 0.42
70 0.38
71 0.34
72 0.36
73 0.3
74 0.27
75 0.26
76 0.27
77 0.29
78 0.35
79 0.36
80 0.37
81 0.44
82 0.46
83 0.51
84 0.55
85 0.6
86 0.61
87 0.62
88 0.62
89 0.61
90 0.66
91 0.68
92 0.65
93 0.64
94 0.58
95 0.61
96 0.65
97 0.69
98 0.73
99 0.74
100 0.78
101 0.7