Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HW50

Protein Details
Accession A0A2I1HW50    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
84-108GEEKYPSSKKKRDREFKKRREEGEKBasic
NLS Segment(s)
PositionSequence
90-104SSKKKRDREFKKRRE
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MSDIYNEQEEIKNRHEIEKHNELREKYQEDPSCLKCYSTDKIEIGDWFKRFWKILQKVVGEAKSYNRNTYVKLLEYIILTRKDGEEKYPSSKKKRDREFKKRREEGEKLLDIIVMSIRYRNEPDYRKVGIISVIKVICEHYILNENDELILNDKAEENLLGNKELLTYGYIIEDDELDIRFAKFEEWLDEKES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.46
4 0.49
5 0.55
6 0.58
7 0.58
8 0.63
9 0.58
10 0.6
11 0.61
12 0.57
13 0.5
14 0.53
15 0.49
16 0.49
17 0.53
18 0.51
19 0.48
20 0.44
21 0.41
22 0.34
23 0.35
24 0.35
25 0.33
26 0.34
27 0.29
28 0.31
29 0.32
30 0.31
31 0.31
32 0.31
33 0.27
34 0.24
35 0.26
36 0.26
37 0.26
38 0.28
39 0.34
40 0.34
41 0.4
42 0.45
43 0.44
44 0.45
45 0.49
46 0.46
47 0.36
48 0.32
49 0.3
50 0.32
51 0.32
52 0.3
53 0.29
54 0.28
55 0.29
56 0.33
57 0.31
58 0.24
59 0.24
60 0.23
61 0.19
62 0.19
63 0.18
64 0.17
65 0.15
66 0.14
67 0.13
68 0.13
69 0.15
70 0.15
71 0.17
72 0.17
73 0.19
74 0.26
75 0.33
76 0.39
77 0.44
78 0.51
79 0.57
80 0.61
81 0.69
82 0.73
83 0.76
84 0.82
85 0.85
86 0.88
87 0.9
88 0.87
89 0.82
90 0.8
91 0.73
92 0.68
93 0.65
94 0.55
95 0.45
96 0.38
97 0.33
98 0.25
99 0.2
100 0.14
101 0.07
102 0.06
103 0.07
104 0.08
105 0.09
106 0.11
107 0.14
108 0.21
109 0.24
110 0.29
111 0.33
112 0.34
113 0.33
114 0.32
115 0.29
116 0.27
117 0.25
118 0.22
119 0.2
120 0.19
121 0.18
122 0.18
123 0.18
124 0.13
125 0.12
126 0.11
127 0.08
128 0.16
129 0.16
130 0.18
131 0.17
132 0.17
133 0.16
134 0.17
135 0.15
136 0.11
137 0.11
138 0.09
139 0.09
140 0.1
141 0.09
142 0.1
143 0.09
144 0.08
145 0.12
146 0.13
147 0.14
148 0.13
149 0.13
150 0.13
151 0.13
152 0.12
153 0.09
154 0.08
155 0.07
156 0.08
157 0.08
158 0.08
159 0.08
160 0.08
161 0.07
162 0.08
163 0.08
164 0.08
165 0.09
166 0.09
167 0.1
168 0.1
169 0.1
170 0.11
171 0.12
172 0.18
173 0.21